KEGG   Homo sapiens (human): 54206Help
Entry
54206             CDS       T01001                                 

Gene name
ERRFI1, GENE-33, MIG-6, MIG6, RALT
Definition
(RefSeq) ERBB receptor feedback inhibitor 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Inhibitor_Mig-6 GTPase_binding
Motif
Other DBs
NCBI-GeneID: 54206
NCBI-ProteinID: NP_061821
OMIM: 608069
HGNC: 18185
Ensembl: ENSG00000116285
Vega: OTTHUMG00000001221
Pharos: Q9UJM3(Tbio)
UniProt: Q9UJM3 I6S2Y9 B3KTV8
Structure
PDB: 

Position
1p36.23
AA seq 462 aa AA seqDB search
MSIAGVAAQEIRVPLKTGFLHNGRAMGNMRKTYWSSRSEFKNNFLNIDPITMAYSLNSSA
QERLIPLGHASKSAPMNGHCFAENGPSQKSSLPPLLIPPSENLGPHEEDQVVCGFKKLTV
NGVCASTPPLTPIKNSPSLFPCAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTD
FLLEDSTLSDFKYDVPGRRSFRGCGQINYAYFDTPAVSAADLSYVSDQNGGVPDPNPPPP
QTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRR
WSAEVTSSTYSDEDRPPKVPPREPLSPSNSRTPSPKSLPSYLNGVMPPTQSFAPDPKYVS
SKALQRQNSEGSASKVPCILPIIENGKKVSSTHYYLLPERPPYLDKYEKFFREAEETNGG
AQIQPLPADCGISSATEKPDSKTKMDLGGHVKRKHLSYVVSP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatagcaggagttgctgctcaggagatcagagtcccattaaaaactggatttcta
cataatggccgagccatggggaatatgaggaagacctactggagcagtcgcagtgagttt
aaaaacaactttttaaatattgacccgataaccatggcctacagtctgaactcttctgct
caggagcgcctaataccacttgggcatgcttccaaatctgctccgatgaatggccactgc
tttgcagaaaatggtccatctcaaaagtccagcttgccccctcttcttattcccccaagt
gaaaacttgggaccacatgaagaggatcaagttgtatgtggttttaagaaactcacagtg
aatggggtttgtgcttccacccctccactgacacccataaaaaactccccttcccttttc
ccctgtgcccctctttgtgaacggggttctaggcctcttccaccgttgccaatctctgaa
gccctctctctggatgacacagactgtgaggtggaattcctaactagctcagatacagac
ttccttttagaagactctacactttctgatttcaaatatgatgttcctggcaggcgaagc
ttccgtgggtgtggacaaatcaactatgcatattttgataccccagctgtttctgcagca
gatctcagctatgtgtctgaccaaaatggaggtgtcccagatccaaatcctcctccacct
cagacccaccgaagattaagaaggtctcattcgggaccagctggctcctttaacaagcca
gccataaggatatccaactgttgtatacacagagcttctcctaactccgatgaagacaaa
cctgaggttccccccagagttcccatacctcctagaccagtaaagccagattatagaaga
tggtcagcagaagttacttcgagcacctatagtgatgaagacaggcctcccaaagtaccg
ccaagagaacctttgtcaccgagtaactcgcgcacaccgagtcccaaaagccttccgtct
tacctcaatggggtcatgcccccgacacagagctttgcccctgatcccaagtatgtcagc
agcaaagcactgcaaagacagaacagcgaaggatctgccagtaaggttccttgcattctg
cccattattgaaaatgggaagaaggttagttcaacacattattacctactacctgaacga
ccaccatacctggacaaatatgaaaaattttttagggaagcagaagaaacaaatggaggc
gcccaaatccagccattacctgctgactgcggtatatcttcagccacagaaaagccagac
tcaaaaacaaaaatggatctgggtggccacgtgaagcgtaaacatttatcctatgtggtt
tctccttag

DBGET integrated database retrieval system