KEGG   Homo sapiens (human): 54209
Entry
54209             CDS       T01001                                 

Gene name
TREM2, PLOSL2, TREM-2, Trem2a, Trem2b, Trem2c
Definition
(RefSeq) triggering receptor expressed on myeloid cells 2
  KO
K14378  triggering receptor expressed on myeloid cells 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Disease
H00438  Nasu-Hakola disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    54209 (TREM2)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set
Other DBs
NCBI-GeneID: 54209
NCBI-ProteinID: NP_061838
OMIM: 605086
HGNC: 17761
Ensembl: ENSG00000095970
Vega: OTTHUMG00000014671
Pharos: Q9NZC2(Tbio)
UniProt: Q9NZC2 Q5TCX1
Structure
PDB: 
5UD8 6B8O 5UD7 5ELI

Position
6p21.1
AA seq 230 aa
MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPC
QRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADT
LRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLA
CIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
NT seq 693 nt   +upstreamnt  +downstreamnt
atggagcctctccggctgctcatcttactctttgtcacagagctgtccggagcccacaac
accacagtgttccagggcgtggcgggccagtccctgcaggtgtcttgcccctatgactcc
atgaagcactgggggaggcgcaaggcctggtgccgccagctgggagagaagggcccatgc
cagcgtgtggtcagcacgcacaacttgtggctgctgtccttcctgaggaggtggaatggg
agcacagccatcacagacgataccctgggtggcactctcaccattacgctgcggaatcta
caaccccatgatgcgggtctctaccagtgccagagcctccatggcagtgaggctgacacc
ctcaggaaggtcctggtggaggtgctggcagaccccctggatcaccgggatgctggagat
ctctggttccccggggagtctgagagcttcgaggatgcccatgtggagcacagcatctcc
aggagcctcttggaaggagaaatccccttcccacccacttccatccttctcctcctggcc
tgcatctttctcatcaagattctagcagccagcgccctctgggctgcagcctggcatgga
cagaagccagggacacatccacccagtgaactggactgtggccatgacccagggtatcag
ctccaaactctgccagggctgagagacacgtga

DBGET integrated database retrieval system