KEGG   Homo sapiens (human): 54210Help
Entry
54210             CDS       T01001                                 

Gene name
TREM1, CD354, TREM-1
Definition
(RefSeq) triggering receptor expressed on myeloid cells 1
  KO
K14362  triggering receptor expressed on myeloid cells 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    54210 (TREM1)
CD molecules [BR:hsa04090]
 Proteins
  54210 (TREM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3
Motif
Other DBs
NCBI-GeneID: 54210
NCBI-ProteinID: NP_061113
OMIM: 605085
HGNC: 17760
Ensembl: ENSG00000124731
Vega: OTTHUMG00000014674
Pharos: Q9NP99(Tbio)
UniProt: Q9NP99 Q38L15
Structure
PDB: 

Position
6p21.1
AA seq 234 aa AA seqDB search
MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRD
GEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPK
EPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKST
ADVSTPDSEINLTNVTDIIRVPVFNIVILLAGGFLSKSLVFSVLFAVTLRSFVP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagaccaggctctgggggctgctgtggatgctctttgtctcagaactccgagct
gcaactaaattaactgaggaaaagtatgaactgaaagaggggcagaccctggatgtgaaa
tgtgactacacgctagagaagtttgccagcagccagaaagcttggcagataataagggac
ggagagatgcccaagaccctggcatgcacagagaggccttcaaagaattcccatccagtc
caagtggggaggatcatactagaagactaccatgatcatggtttactgcgcgtccgaatg
gtcaaccttcaagtggaagattctggactgtatcagtgtgtgatctaccagcctcccaag
gagcctcacatgctgttcgatcgcatccgcttggtggtgaccaagggtttttcagggacc
cctggctccaatgagaattctacccagaatgtgtataagattcctcctaccaccactaag
gccttgtgcccactctataccagccccagaactgtgacccaagctccacccaagtcaact
gccgatgtctccactcctgactctgaaatcaaccttacaaatgtgacagatatcatcagg
gttccggtgttcaacattgtcattctcctggctggtggattcctgagtaagagcctggtc
ttctctgtcctgtttgctgtcacgctgaggtcatttgtaccctag

DBGET integrated database retrieval system