KEGG   Homo sapiens (human): 5427Help
Entry
5427              CDS       T01001                                 

Gene name
POLE2, DPE2
Definition
(RefSeq) DNA polymerase epsilon 2, accessory subunit
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
hsa03030  DNA replication
hsa03410  Base excision repair
hsa03420  Nucleotide excision repair
hsa05166  Human T-cell leukemia virus 1 infection
Module
hsa_M00263  DNA polymerase epsilon complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5427 (POLE2)
   00240 Pyrimidine metabolism
    5427 (POLE2)
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5427 (POLE2)
   03410 Base excision repair
    5427 (POLE2)
   03420 Nucleotide excision repair
    5427 (POLE2)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    5427 (POLE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5427 (POLE2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5427 (POLE2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     5427 (POLE2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    5427 (POLE2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      5427 (POLE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_E_B Dpoe2NT DUF3689
Motif
Other DBs
NCBI-GeneID: 5427
NCBI-ProteinID: NP_002683
OMIM: 602670
HGNC: 9178
Ensembl: ENSG00000100479
Vega: OTTHUMG00000170813
Pharos: P56282(Tbio)
UniProt: P56282
Structure
PDB: 

Position
14q21.3
AA seq 527 aa AA seqDB search
MAPERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSN
MIERSVVEAAVQECSQSVDETIEHVFNIIGAFDIPRFVYNSERKKFLPLLMTNHPAPNLF
GTPRDKAEMFRERYTILHQRTHRHELFTPPVIGSHPDESGSKFQLKTIETLLGSTTKIGD
AIVLGMITQLKEGKFFLEDPTGTVQLDLSKAQFHSGLYTEACFVLAEGWFEDQVFHVNAF
GFPPTEPSSTTRAYYGNINFFGGPSNTSVKTSAKLKQLEEENKDAMFVFLSDVWLDQVEV
LEKLRIMFAGYSPAPPTCFILCGNFSSAPYGKNQVQALKDSLKTLADIICEYPDIHQSSR
FVFVPGPEDPGFGSILPRPPLAESITNEFRQRVPFSVFTTNPCRIQYCTQEITVFREDLV
NKMCRNCVRFPSSNLAIPNHFVKTILSQGHLTPLPLYVCPVYWAYDYALRVYPVPDLLVI
ADKYDPFTTTNTECLCINPGSFPRSGFSFKVFYPSNKTVEDSKLQGF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggagcggctgcggagccgggcgctctccgccttcaagttgcggggcttgctg
ctccgtggtgaagctattaagtacctcacagaagctcttcagtctatcagtgaattagag
cttgaagataaactggaaaagataattaatgcagttgagaagcaacccttgtcatcaaac
atgattgaacgatctgtggtggaagcagcagtccaggaatgcagtcagtctgttgatgaa
actatagagcacgttttcaatatcataggagcatttgatattccacgctttgtgtacaat
tcagaaagaaaaaaatttcttcctctgttaatgaccaaccaccctgcaccaaatttattt
ggaacaccaagagataaagcagagatgtttcgtgagcgatataccattttgcaccagagg
acccacaggcatgaattatttactcctccggtgataggttctcaccctgatgaaagcgga
agcaaattccagcttaaaacaatagaaaccttattgggtagtacaaccaaaatcggagat
gcgattgttcttggaatgataacgcagttaaaagagggaaaattttttctggaagatcct
actggaacagtccaactagaccttagtaaagctcagttccatagtggtttatacacagag
gcatgctttgtcttagcagaaggttggtttgaagatcaagtgtttcatgtcaatgccttt
ggatttccacccactgagccctctagtactactagggcatactatggaaatattaatttt
tttggaggtccttctaatacatctgtgaagacttctgcaaaactaaaacagctagaagag
gagaataaagatgctatgtttgtgtttttatctgatgtttggttggaccaggtggaagta
ttggaaaaacttcgcataatgtttgctggttattcaccagcacctccaacctgctttatt
ctgtgtggtaatttttcatctgcaccatatggaaaaaatcaagttcaagctttgaaagat
tccctaaaaactttggcagatataatatgtgaatacccagatattcaccaaagtagtcgt
tttgtgtttgtacctggtccagaggatcctggatttggttccatcttaccaaggccacca
cttgctgaaagcatcactaatgaattcagacaaagggtaccattttcagtttttactact
aatccttgcagaattcagtactgtacacaggaaattactgtcttccgtgaagacttagta
aataaaatgtgcagaaactgcgtccgttttcctagcagcaatttggctattcctaatcac
tttgtaaagactatcttatcccaaggacatctgactcccctacctctttatgtctgccca
gtgtattgggcatatgactatgctttgagagtgtatcctgtgcccgatctacttgtcatt
gcagacaaatatgatcctttcactacgacaaataccgaatgcctctgcataaaccctggc
tcttttccaagaagtggattttcattcaaagttttttatccttctaataagacagtagaa
gatagcaaacttcaaggcttttga

DBGET integrated database retrieval system