KEGG   Homo sapiens (human): 5430Help
Entry
5430              CDS       T01001                                 

Gene name
POLR2A, POLR2, POLRA, RPB1, RPBh1, RPO2, RPOL2, RpIILS, hRPB220, hsRPB1
Definition
(RefSeq) RNA polymerase II subunit A
  KO
K03006  DNA-directed RNA polymerase II subunit RPB1 [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5430 (POLR2A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5430 (POLR2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5430 (POLR2A)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5430 (POLR2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     5430 (POLR2A)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     5430 (POLR2A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5430 (POLR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_6 RNA_pol_Rpb1_7 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 RNA_pol_Rpb1_R
Motif
Other DBs
NCBI-GeneID: 5430
NCBI-ProteinID: NP_000928
OMIM: 180660
HGNC: 9187
Ensembl: ENSG00000181222
Vega: OTTHUMG00000177594
Pharos: P24928(Tbio)
UniProt: P24928
Structure
PDB: 

Position
17p13.1
AA seq 1970 aa AA seqDB search
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN
NT seq 5913 nt NT seq  +upstreamnt  +downstreamnt
atgcacgggggtggccccccctcgggggacagcgcatgcccgctgcgcaccatcaagaga
gtccagttcggagtcctgagtccggatgaactgaagcgaatgtctgtgacggagggtggc
atcaaatacccagagacgactgagggaggccgccccaagcttggggggctgatggacccg
aggcagggggtgattgagcggactggccgctgccaaacatgtgcaggaaacatgacagag
tgtcctggccactttggccacattgaactggccaagcctgtgtttcacgtgggcttcctg
gtgaagacaatgaaagttttgcgctgtgtctgcttcttctgctccaaactgcttgtggac
tctaacaacccaaagatcaaggatatcctggctaagtccaagggacagcccaagaagcgg
ctcacacatgtctacgacctttgcaagggcaaaaacatatgcgagggtggggaggagatg
gacaacaagttcggtgtggaacaacctgagggtgacgaggatctgaccaaagaaaagggc
catggtggctgtgggcggtaccagcccaggatccggcgttctggcctagagctgtatgcg
gaatggaagcacgttaatgaggactctcaggagaagaagatcctgctgagtccagagcga
gtgcatgagatcttcaaacgcatctcagatgaggagtgttttgtgctgggcatggagccc
cgctatgcacggccagagtggatgattgtcacagtgctgcctgtgcccccgctctccgtg
cggcctgctgttgtgatgcagggctctgcccgtaaccaggatgacctgactcacaaactg
gctgacatcgtgaagatcaacaatcagctgcggcgcaatgagcagaacggcgcagcggcc
catgtcattgcagaggatgtgaagctcctccagttccatgtggccaccatggtggacaat
gagctgcctggcttgccccgtgccatgcagaagtctgggcgtcccctcaagtccctgaag
cagcggttgaagggcaaggaaggccgggtgcgagggaacctgatgggcaaaagagtggac
ttctcggcccgtactgtcatcacccccgaccccaacctctccattgaccaggttggcgtg
ccccgctccattgctgccaacatgacctttgcggagattgtcacccccttcaacattgac
agacttcaagaactagtgcgcagggggaacagccagtacccaggcgccaagtacatcatc
cgagacaatggtgatcgcattgacttgcgtttccaccccaagcccagtgaccttcacctg
cagaccggctataaggtggaacggcacatgtgtgatggggacattgttatcttcaaccgg
cagccaactctgcacaaaatgtccatgatggggcatcgggtccgcattctcccatggtct
acctttcgcttgaatcttagtgtgacaactccgtacaatgcagactttgacggggatgag
atgaacttgcacctgccacagtctctggagacgcgagcagagatccaggagctggccatg
gttcctcgcatgattgtcaccccccagagcaatcggcctgtcatgggtattgtgcaggac
acactcacagcagtgcgcaaattcaccaagagagacgtcttcctggagcggggtgaagtg
atgaacctcctgatgttcctgtcgacgtgggatgggaaggtcccacagccggccatccta
aagccccggcccctgtggacaggcaagcaaatcttctccctcatcatacctggtcacatc
aattgtatccgtacccacagcacccatcccgatgatgaagacagtggcccttacaagcac
atctctcctggggacaccaaggtggtggtggagaatggggagctgatcatgggcatcctg
tgtaagaagtctctgggcacgtcagctggctccctggtccacatctcctacctagagatg
ggtcatgacatcactcgcctcttctactccaacattcagactgtcattaacaactggctc
ctcatcgagggtcatactattggcattggggactccattgctgattctaagacttaccag
gacattcagaacactattaagaaggccaagcaggacgtaatagaggtcatcgagaaggca
cacaacaatgagctggagcccaccccagggaacactctgcggcagacgtttgagaatcag
gtgaaccgcattcttaacgatgcccgagacaagactggctcctctgctcagaaatccctg
tctgaatacaataacttcaagtctatggtcgtgtccggagctaaaggttccaagattaac
atctcccaggtcattgctgtcgttggacagcagaacgtcgagggcaagcggattccattt
ggcttcaagcaccggactctgcctcacttcatcaaggatgactacgggcctgagagccgt
ggctttgtggagaactcctacctagccggcctcacacccactgagttctttttccacgcc
atggggggtcgtgaggggctcattgacacggctgtcaagactgctgagactggatacatc
cagcggcggctgatcaagtccatggagtcagtgatggtgaagtacgacgcgactgtgcgg
aactccatcaaccaggtggtgcagctgcgctacggcgaagacggcctggcaggcgagagc
gttgagttccagaacctggctacgcttaagccttccaacaaggcttttgagaagaagttc
cgctttgattataccaatgagagggccctgcggcgcactctgcaggaggacctggtgaag
gacgtgctgagcaacgcacacatccagaacgagttggagcgggaatttgagcggatgcgg
gaggatcgggaggtgctcagggtcatcttcccaactggagacagcaaggtcgtcctcccc
tgtaacctgctgcggatgatctggaatgctcagaaaatcttccacatcaacccacgcctt
ccctccgacctgcaccccatcaaagtggtggagggagtcaaggaattgagcaagaagctg
gtgattgtgaatggggatgacccactaagtcgacaggcccaggaaaatgccacgctgctc
ttcaacatccacctgcggtccacgttgtgttcccgccgcatggcagaggagtttcggctc
agtggggaggccttcgactggctgcttggggagattgagtccaagttcaaccaagccatt
gcgcatcccggggaaatggtgggggctctggctgcgcagtcccttggagaacctgccacc
cagatgaccttgaataccttccactatgctggtgtgtctgccaagaatgtgacgctgggt
gtgccccgacttaaggagctcatcaacatttccaagaagccaaagactccttcgcttact
gtcttcctgttgggccagtccgctcgagatgctgagagagccaaggatattctgtgccgt
ctggagcatacaacgttgaggaaggtgactgccaacacagccatctactatgaccccaac
ccccagagcacggtggtggcagaggatcaggaatgggtgaatgtctactatgaaatgcct
gactttgatgtggcccgaatctccccctggctgttgcgggtggagctggatcggaagcac
atgactgaccggaagctcaccatggagcagattgctgaaaagatcaatgctggttttggt
gacgacttgaactgcatctttaatgatgacaatgcagagaagctggtgctccgtattcgc
atcatgaacagcgatgagaacaagatgcaagaggaggaagaggtggtggacaagatggat
gatgatgtcttcctgcgctgcatcgagtccaacatgctgacagatatgaccctgcagggc
atcgagcagatcagcaaggtgtacatgcacttgccacagacagacaacaagaagaagatc
atcatcacggaggatggggaattcaaggccctgcaggagtggatcctggagacggacggc
gtgagcttgatgcgggtgctgagtgagaaggacgtggaccccgtacgcaccacgtccaat
gacattgtggagatcttcacggtgctgggcattgaagccgtgcggaaggccctggagcgg
gagctgtaccacgtcatctcctttgatggctcctatgtcaattaccgacacttggctctc
ttgtgtgataccatgacctgtcgtggccacttgatggccatcacccgacacggagtcaac
cgccaggacacaggaccactcatgaagtgttcctttgaggaaacggtggacgtgcttatg
gaagcagccgcacacggtgagagtgaccccatgaagggggtctctgagaatatcatgctg
ggccagctggctccggccggcactggctgctttgacctcctgcttgatgcagagaagtgc
aagtatggcatggagatccccaccaatatccccggcctgggggctgctggacccaccggc
atgttctttggttcagcacccagtcccatgggtggaatctctcctgccatgacaccttgg
aaccagggtgcaacccctgcctatggcgcctggtcccccagtgttgggagtggaatgacc
ccaggggcagccggcttctctcccagtgctgcgtcagatgccagcggcttcagcccaggt
tactcccctgcctggtctcccacaccgggctccccggggtccccaggtccctcaagcccc
tacatcccttcaccaggtggtgccatgtctcccagctactcgccaacgtcacctgcctac
gagccccgctctcctgggggctacacaccccagagtccctcttattcccccacttcaccc
tcctactcccctacctctccatcctattctccaaccagtcccaactatagtcccacatca
cccagctattcgccaacgtcacccagctactcaccgacctctcccagctactcacccacc
tctcccagctactcgcccacctctcccagctactcgcccacctctcccagctactcaccc
acttcccctagctactcgcccacttcccctagctactcgccaacgtctcccagctactcg
ccgacatctcccagctactcgccaacttcacccagctattctcccacttctcccagctac
tcacctacctctccaagctattcacccacctcccccagctactcacccacttccccaagt
tactcacccaccagcccgaactattctccaaccagtcccaattacaccccaacatcaccc
agctacagcccgacatcacccagctattcacctactagtcccaactacacacctaccagc
cctaactacagcccaacctctccaagctactctccaacatcacccagctattccccgacc
tcaccaagttactccccttccagcccacgatacacaccacagtctccaacctatacccca
agctcacccagctacagccccagctcgcccagctacagcccaacctcacccaagtacacc
ccaaccagtccttcttacagtcccagctccccagagtataccccaacctctcccaagtac
tcacctaccagtcccaaatattcacccacctctcccaagtactcgcctaccagtcccacc
tattcacccaccaccccaaaatactccccaacatctcctacttattccccaacctctcca
gtctacaccccaacctctcccaagtactcacctactagccccacttactcgcccacttcc
cccaagtactcgcccaccagccccacctactcgcccacctcccccaaaggctcaacctac
tctcccacttcccctggttactcgcccaccagccccacctacagtctcacaagcccggct
atcagcccggatgacagtgacgaggagaactga

DBGET integrated database retrieval system