KEGG   Homo sapiens (human): 54328
Entry
54328             CDS       T01001                                 

Gene name
GPR173, SREB3
Definition
(RefSeq) G protein-coupled receptor 173
  KO
K04300  super conserved receptor expressed in brain 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    54328 (GPR173)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Gonadotropin-releasing hormone (GnRH)
    54328 (GPR173)
  Others
   Super conserved receptor expressed in brain (SREB)
    54328 (GPR173)
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 54328
NCBI-ProteinID: NP_061842
OMIM: 300253
HGNC: 18186
Ensembl: ENSG00000184194
Vega: OTTHUMG00000021596
Pharos: Q9NS66(Tdark)
UniProt: Q9NS66
Position
Xp11.22
AA seq 373 aa
MANTTGEPEEVSGALSPPSASAYVKLVLLGLIMCVSLAGNAILSLLVLKERALHKAPYYF
LLDLCLADGIRSAVCFPFVLASVRHGSSWTFSALSCKIVAFMAVLFCFHAAFMLFCISVT
RYMAIAHHRFYAKRMTLWTCAAVICMAWTLSVAMAFPPVFDVGTYKFIREEDQCIFEHRY
FKANDTLGFMLMLAVLMAATHAVYGKLLLFEYRHRKMKPVQMVPAISQNWTFHGPGATGQ
AAANWIAGFGRGPMPPTLLGIRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWS
PYIVACYWRVFVKACAVPHRYLATAVWMSFAQAAVNPIVCFLLNKDLKKCLRTHAPCWGT
GGAPAPREPYCVM
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggccaacactaccggagagcctgaggaggtgagcggcgctctgtccccaccgtccgca
tcagcttatgtgaagctggtactgctgggactgattatgtgcgtgagcctggcgggtaac
gccatcttgtccctgctggtgctcaaggagcgtgccctgcacaaggctccttactacttc
ctgctggacctgtgcctggccgatggcatacgctctgccgtctgcttcccctttgtgctg
gcttctgtgcgccacggctcttcatggaccttcagtgcactcagctgcaagattgtggcc
tttatggccgtgctcttttgcttccatgcggccttcatgctgttctgcatcagcgtcacc
cgctacatggccatcgcccaccaccgcttctacgccaagcgcatgacactctggacatgc
gcggctgtcatctgcatggcctggaccctgtctgtggccatggccttcccacctgtcttt
gacgtgggcacctacaagtttattcgggaggaggaccagtgcatctttgagcatcgctac
ttcaaggccaatgacacgctgggcttcatgcttatgttggctgtgctcatggcagctacc
catgctgtctacggcaagctgctcctcttcgagtatcgtcaccgcaagatgaagccagtg
cagatggtgccagccatcagccagaactggacattccatggtcccggggccaccggccag
gctgctgccaactggatcgccggctttggccgtgggcccatgccaccaaccctgctgggt
atccggcagaatgggcatgcagccagccggcggctactgggcatggacgaggtcaagggt
gaaaagcagctgggccgcatgttctacgcgatcacactgctctttctgctcctctggtca
ccctacatcgtggcctgctactggcgagtgtttgtgaaagcctgtgctgtgccccaccgc
tacctggccactgctgtttggatgagcttcgcccaggctgccgtcaacccaattgtctgc
ttcctgctcaacaaggacctcaagaagtgcctgaggactcacgccccctgctggggcaca
ggaggtgccccggctcccagagaaccctactgtgtcatgtga

DBGET integrated database retrieval system