KEGG   Homo sapiens (human): 54329
Entry
54329             CDS       T01001                                 

Gene name
GPR85, SREB, SREB2
Definition
(RefSeq) G protein-coupled receptor 85
  KO
K04302  super conserved receptor expressed in brain 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    54329 (GPR85)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Super conserved receptor expressed in brain (SREB)
    54329 (GPR85)
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 54329
NCBI-ProteinID: NP_001139737
OMIM: 605188
HGNC: 4536
Ensembl: ENSG00000164604
Vega: OTTHUMG00000156933
Pharos: P60893(Tbio)
UniProt: P60893 A4D0T8 Q8NEN2
Position
7q31.1
AA seq 370 aa
MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLL
DLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRY
LAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFR
ANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVAAVSQNWTFHGPGASGQAA
ANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGP
YLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCFSTTLLYCRKS
RLPREPYCVI
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggcgaactatagccatgcagctgacaacattttgcaaaatctctcgcctctaacagcc
tttctgaaactgacttccttgggtttcataataggagtcagcgtggtgggcaacctcctg
atctccattttgctagtgaaagataagaccttgcatagagcaccttactacttcctgttg
gatctttgctgttcagatatcctcagatctgcaatttgtttcccatttgtgttcaactct
gtcaaaaatggttctacctggacttatgggactctgacttgcaaagtgattgcctttctg
ggggttttgtcctgtttccacactgctttcatgctcttctgcatcagtgtcaccagatac
ttagctatcgcccatcaccgcttctatacaaagaggctgaccttttggacgtgtctggct
gtgatctgtatggtgtggactctgtctgtggccatggcatttcccccggttttagacgtg
ggcacttactcattcattagggaggaagatcaatgcaccttccaacaccgctccttcagg
gctaatgattccttaggatttatgctgcttcttgctctcatcctcctagccacacagctt
gtctacctcaagctgatatttttcgtccacgatcgaagaaaaatgaagccagtccagttt
gtagcagcagtcagccagaactggacttttcatggtcctggagccagtggccaggcagct
gccaattggctagcaggatttggaaggggtcccacaccacccaccttgctgggcatcagg
caaaatgcaaacaccacaggcagaagaaggctattggtcttagacgagttcaaaatggag
aaaagaatcagcagaatgttctatataatgacttttctgtttctaaccttgtggggcccc
tacctggtggcctgttattggagagtttttgcaagagggcctgtagtaccagggggattt
ctaacagctgctgtctggatgagttttgcccaagcaggaatcaatccttttgtctgcatt
ttctcaaacagggagctgaggcgctgtttcagcacaacccttctttactgcagaaaatcc
aggttaccaagggaaccttactgtgttatatga

DBGET integrated database retrieval system