KEGG   Homo sapiens (human): 5433Help
Entry
5433              CDS       T01001                                 

Gene name
POLR2D, HSRBP4, HSRPB4, RBP4, RPB16
Definition
(RefSeq) RNA polymerase II subunit D
  KO
K03012  DNA-directed RNA polymerase II subunit RPB4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Module
hsa_M00180  RNA polymerase II, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5433 (POLR2D)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    5433 (POLR2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5433 (POLR2D)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5433 (POLR2D)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     5433 (POLR2D)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5433 (POLR2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb4 Maelstrom Tfb4
Motif
Other DBs
NCBI-GeneID: 5433
NCBI-ProteinID: NP_004796
OMIM: 606017
HGNC: 9191
Ensembl: ENSG00000144231
Vega: OTTHUMG00000131531
Pharos: O15514(Tdark)
UniProt: O15514 A0A024RAJ4
Structure
PDB: 

Position
2q14.3
AA seq 142 aa AA seqDB search
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgggtggcagcgatccgcgggctggcgacgtagaggaggacgcctcacagctc
atctttcctaaagagtttgaaacagctgagacacttctaaattcagaagttcatatgctt
ctggaacatcgaaagcagcagaatgagagtgcagaggacgaacaggagctctcagaagtc
ttcatgaaaacattaaactacacagcccgtttcagtcgtttcaaaaacagagagaccatt
gccagtgttcgtagcttgctactccagaaaaagcttcataagtttgagttggcctgtttg
gccaacctttgcccagagactgctgaggagtccaaggctctaatcccaagcttggaggga
cggtttgaagatgaggagctgcagcagattcttgatgatatccagacaaagcgcagcttt
cagtattaa

DBGET integrated database retrieval system