KEGG   Homo sapiens (human): 5434Help
Entry
5434              CDS       T01001                                 

Gene name
POLR2E, RPABC1, RPB5, XAP4, hRPB25, hsRPB5
Definition
(RefSeq) RNA polymerase II subunit E
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5434 (POLR2E)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    5434 (POLR2E)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5434 (POLR2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5434 (POLR2E)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5434 (POLR2E)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     5434 (POLR2E)
  RNA polymerase III system
   RNA polymerase III
     5434 (POLR2E)
  RNA polymerase I system
   RNA polymerase I
     5434 (POLR2E)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5434 (POLR2E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N
Motif
Other DBs
NCBI-GeneID: 5434
NCBI-ProteinID: NP_002686
OMIM: 180664
HGNC: 9192
Ensembl: ENSG00000099817
Vega: OTTHUMG00000181873
Pharos: P19388(Tbio)
UniProt: P19388
Structure
PDB: 

Position
19p13.3
AA seq 210 aa AA seqDB search
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgaggaggagacgtaccggctctggaaaatccgcaagaccatcatgcagctg
tgccacgaccgtggctatctggtgacccaggacgagcttgaccagaccctggaggagttc
aaagcccaatttggggacaagccgagtgaggggcggccgcggcgcacggacctcaccgtg
ctggtggcccacaacgatgaccccaccgaccagatgtttgtgttctttccagaggagccc
aaggtgggcatcaagaccatcaaggtgtactgccagcgcatgcaggaggagaacatcaca
cgggctctcatcgtggtgcagcagggcatgacaccctccgccaagcagtccctggtcgac
atggcccccaagtacatcctggagcagtttctgcagcaggagctgctcatcaacatcacg
gagcacgagctagtccctgagcacgtcgtcatgaccaaggaggaggtgacagagctgctg
gcccgatataagctccgagagaaccagctgcccaggatccaggcgggggaccctgtggcg
cgctactttgggataaagcgtgggcaggtggtgaagatcatccggcccagtgagacggct
ggcaggtacatcacctaccggctggtgcagtag

DBGET integrated database retrieval system