KEGG   Homo sapiens (human): 54360
Entry
54360             CDS       T01001                                 

Symbol
CYTL1, C17, C4orf4
Name
(RefSeq) cytokine like 1
  KO
K25418  cytokine-like protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    54360 (CYTL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   54360 (CYTL1)
SSDB
Motif
Pfam: CYTL1 Thoc2
Other DBs
NCBI-GeneID: 54360
NCBI-ProteinID: NP_061129
OMIM: 607930
HGNC: 24435
Ensembl: ENSG00000170891
Vega: OTTHUMG00000125479
Pharos: Q9NRR1(Tbio)
UniProt: Q9NRR1
Position
4:complement(5014586..5019470)
AA seq 136 aa
MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPR
LYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNA
LEYPIPVTTVLPDRQR
NT seq 411 nt   +upstreamnt  +downstreamnt
atgaggacgcctgggcctctgcccgtgctgctgctgctcctggcgggagcccccgccgcg
cggcccactcccccgacctgctactcccgcatgcgggccctgagccaggagatcacccgc
gacttcaacctcctgcaggtctcggagccctcggagccatgtgtgagatacctgcccagg
ctgtacctggacatacacaattactgtgtgctggacaagctgcgggactttgtggcctcg
cccccgtgttggaaagtggcccaggtagattccttgaaggacaaagcacggaagctgtac
accatcatgaactcgttctgcaggagagatttggtattcctgttggatgactgcaatgcc
ttggaatacccaatcccagtgactacggtcctgccagatcgtcagcgctaa

DBGET integrated database retrieval system