KEGG   Homo sapiens (human): 54363
Entry
54363             CDS       T01001                                 
Symbol
HAO1, GO, GOX, GOX1, HAOX1
Name
(RefSeq) hydroxyacid oxidase 1
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04146  Peroxisome
Drug target
Lumasiran: D11925 D11926<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    54363 (HAO1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    54363 (HAO1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     54363 (HAO1)
SSDB
Motif
Pfam: FMN_dh IMPDH Glu_synthase His_biosynth ThiG NMO TMP-TENI DHO_dh Peptidase_C32
Other DBs
NCBI-GeneID: 54363
NCBI-ProteinID: NP_060015
OMIM: 605023
HGNC: 4809
Ensembl: ENSG00000101323
Pharos: Q9UJM8(Tchem)
UniProt: Q9UJM8 A8K058
Structure
Position
20:complement(7882985..7940458)
AA seq 370 aa
MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAET
DLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSSIEEVAE
AGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLPPQ
LRMKNFETSTLSFSPEENFGDDSGLAAYVAKAIDPSISWEDIKWLRRLTSLPIVAKGILR
GDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV
LKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVIDKTLV
RKNPLAVSKI
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgctcccccggctaatttgtatcaatgattatgaacaacatgctaaatcagtacttcca
aagtctatatatgactattacaggtctggggcaaatgatgaagaaactttggctgataat
attgcagcattttccagatggaagctgtatccaaggatgctccggaatgttgctgaaaca
gatctgtcgacttctgttttaggacagagggtcagcatgccaatatgtgtgggggctacg
gccatgcagcgcatggctcatgtggacggcgagcttgccactgtgagagcctgtcagtcc
ctgggaacgggcatgatgttgagttcctgggccacctcctcaattgaagaagtggcggaa
gctggtcctgaggcacttcgttggctgcaactgtatatctacaaggaccgagaagtcacc
aagaagctagtgcggcaggcagagaagatgggctacaaggccatatttgtgacagtggac
acaccttacctgggcaaccgtctggatgatgtgcgtaacagattcaaactgccgccacaa
ctcaggatgaaaaattttgaaaccagtactttatcattttctcctgaggaaaattttgga
gacgacagtggacttgctgcatatgtggctaaagcaatagacccatctatcagctgggaa
gatatcaaatggctgagaagactgacatcattgccaattgttgcaaagggcattttgaga
ggtgatgatgccagggaggctgttaaacatggcttgaatgggatcttggtgtcgaatcat
ggggctcgacaactcgatggggtgccagccactattgatgttctgccagaaattgtggag
gctgtggaagggaaggtggaagtcttcctggacgggggtgtgcggaaaggcactgatgtt
ctgaaagctctggctcttggcgccaaggctgtgtttgtggggagaccaatcgtttggggc
ttagctttccagggggagaaaggtgttcaagatgtcctcgagatactaaaggaagaattc
cggttggccatggctctgagtgggtgccagaatgtgaaagtcatcgacaagacattggtg
aggaaaaatcctttggccgtttccaagatctga

DBGET integrated database retrieval system