KEGG   Homo sapiens (human): 5439Help
Entry
5439              CDS       T01001                                 

Gene name
POLR2J, POLR2J1, RPB11, RPB11A, RPB11m, hRPB14
Definition
(RefSeq) RNA polymerase II subunit J
  KO
K03008  DNA-directed RNA polymerase II subunit RPB11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5439 (POLR2J)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5439 (POLR2J)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5439 (POLR2J)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5439 (POLR2J)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     5439 (POLR2J)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5439 (POLR2J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_L_2 RNA_pol_L
Motif
Other DBs
NCBI-GeneID: 5439
NCBI-ProteinID: NP_006225
OMIM: 604150
HGNC: 9197
Ensembl: ENSG00000005075
Vega: OTTHUMG00000150387
Pharos: P52435(Tbio)
UniProt: P52435
Structure
PDB: 

Position
7q22.1
AA seq 117 aa AA seqDB search
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccctccagccttcgagtcgttcttgctcttcgagggcgagaagaagatcacc
attaacaaggacaccaaggtacccaatgcctgtttattcaccatcaacaaagaagaccac
acactgggaaacatcattaaatcacaactcctaaaagacccgcaagtgctatttgctggc
tacaaagtcccccaccccttggagcacaagatcatcatccgagtgcagaccacgccggac
tacagcccccaggaagcctttaccaacgccatcaccgacctcatcagtgagctgtccctg
ctggaggagcgctttcgggtggccataaaagacaagcaggaaggaattgagtag

DBGET integrated database retrieval system