KEGG   Homo sapiens (human): 5440Help
Entry
5440              CDS       T01001                                 

Gene name
POLR2K, ABC10-alpha, RPABC4, RPB10alpha, RPB12, RPB7.0, hRPB7.0, hsRPB10a
Definition
(RefSeq) RNA polymerase II subunit K
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05016  Huntington disease
Module
hsa_M00180  RNA polymerase II, eukaryotes
hsa_M00181  RNA polymerase III, eukaryotes
hsa_M00182  RNA polymerase I, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5440 (POLR2K)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    5440 (POLR2K)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    5440 (POLR2K)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5440 (POLR2K)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5440 (POLR2K)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     5440 (POLR2K)
  RNA polymerase III system
   RNA polymerase III
     5440 (POLR2K)
  RNA polymerase I system
   RNA polymerase I
     5440 (POLR2K)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5440 (POLR2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_RNApol_7kD A2L_zn_ribbon Cytochrome_C7 HypA MCM_OB DZR zinc_ribbon_13
Motif
Other DBs
NCBI-GeneID: 5440
NCBI-ProteinID: NP_005025
OMIM: 606033
HGNC: 9198
Ensembl: ENSG00000147669
Vega: OTTHUMG00000164705
Pharos: P53803(Tbio)
UniProt: P53803 A0A024R9G0
Structure
PDB: 

Position
8q22.2
AA seq 58 aa AA seqDB search
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atggacacccagaaggacgttcaacctccaaagcagcaaccaatgatatatatctgtgga
gagtgtcacacagaaaatgaaataaaatctagggatccaatcagatgcagagaatgtgga
tacagaataatgtacaagaaaaggactaaaagattggtcgtttttgatgctcgatga

DBGET integrated database retrieval system