KEGG   Homo sapiens (human): 54407Help
Entry
54407             CDS       T01001                                 

Gene name
SLC38A2, ATA2, PRO1068, SAT2, SNAT2
Definition
(RefSeq) solute carrier family 38 member 2
  KO
K14207  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04724  Glutamatergic synapse
hsa04727  GABAergic synapse
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    54407 (SLC38A2)
  09156 Nervous system
   04724 Glutamatergic synapse
    54407 (SLC38A2)
   04727 GABAergic synapse
    54407 (SLC38A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    54407 (SLC38A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   54407 (SLC38A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aa_trans
Motif
Other DBs
NCBI-GeneID: 54407
NCBI-ProteinID: NP_061849
OMIM: 605180
HGNC: 13448
Ensembl: ENSG00000134294
Vega: OTTHUMG00000169471
Pharos: Q96QD8(Tbio)
UniProt: Q96QD8 A0A024R0W3
Position
12q13.11
AA seq 506 aa AA seqDB search
MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKK
KYETEFHPGTTSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVH
LLLKTANEGGSLLYEQLGYKAFGLVGKLAASGSITMQNIGAMSSYLFIVKYELPLVIQAL
TNIEDKTGLWYLNGNYLVLLVSLVVILPLSLFRNLGYLGYTSGLSLLCMVFFLIVVICKK
FQVPCPVEAALIINETINTTLTQPTALVPALSHNVTENDSCRPHYFIFNSQTVYAVPILI
FSFVCHPAVLPIYEELKDRSRRRMMNVSKISFFAMFLMYLLAALFGYLTFYEHVESELLH
TYSSILGTDILLLIVRLAVLMAVTLTVPVVIFPIRSSVTHLLCASKDFSWWRHSLITVSI
LAFTNLLVIFVPTIRDIFGFIGASAASMLIFILPSAFYIKLVKKEPMKSVQKIGALFFLL
SGVLVMTGSMALIVLDWVHNAPGGGH
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggccgaaatgggacgattcagtatttccccggatgaagacagcagcagctac
agttccaacagcgacttcaactactcctaccccaccaagcaagctgctctgaaaagccat
tatgcagatgtagatcctgaaaaccagaactttttacttgaatcgaatttggggaagaag
aagtatgaaacagaatttcatccaggtactacttcctttggaatgtcagtatttaatctg
agcaatgcgattgtgggcagtggaatccttgggctttcttatgccatggctaatactgga
attgctctttttataattctcttgacatttgtgtcaatattttccctgtattctgttcat
ctccttttgaagactgccaatgaaggagggtctttattatatgaacaattgggatataag
gcatttggattagttggaaagcttgcagcatctggatcaattacaatgcagaacattgga
gctatgtcaagctacctcttcatagtgaaatatgagttgcctttggtgatccaggcatta
acgaacattgaagataaaactggattgtggtatctgaacgggaactatttggttctgttg
gtgtcattggtggtcattcttcctttgtcgctgtttagaaatttaggatatttgggatat
accagtggcctttccttgttgtgtatggtgttctttctgattgtggtcatttgcaagaaa
tttcaggttccgtgtcctgtggaagctgctttgataattaacgaaacaataaacaccacc
ttaacacagccaacagctcttgtacctgctttgtcacataacgtgactgaaaatgactct
tgcagacctcactattttattttcaactcacagactgtctatgctgtgccaattctgatc
ttttcatttgtctgtcatcctgctgttcttcccatctatgaagaactgaaagaccgcagc
cgtagaagaatgatgaatgtgtccaagatttcattttttgctatgtttctcatgtatctg
cttgccgccctctttggatacctaacattttacgaacatgttgagtcagaattgcttcat
acctactcttctatcttgggaactgatattcttcttctcattgtccgtctggctgtgtta
atggctgtgaccctgacagtaccagtagttattttcccaatccggagttctgtaactcac
ttgttgtgtgcatcaaaagatttcagttggtggcgtcatagtctcattacagtgtctatc
ttggcatttaccaatttacttgtcatctttgtcccaactattagggatatctttggtttt
attggtgcatctgcagcttctatgttgatttttattcttccttctgccttctatatcaag
ttggtgaagaaagaacctatgaaatctgtacaaaagattggggctttgttcttcctgtta
agtggtgtactggtgatgaccggaagcatggccttgattgttttggattgggtacacaat
gcacctggaggtggccattaa

DBGET integrated database retrieval system