KEGG   Homo sapiens (human): 54413
Entry
54413             CDS       T01001                                 
Symbol
NLGN3, HNL3
Name
(RefSeq) neuroligin 3
  KO
K07378  neuroligin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Disease
H01882  Asperger syndrome
H02111  Autism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    54413 (NLGN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    54413 (NLGN3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    54413 (NLGN3)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3
Other DBs
NCBI-GeneID: 54413
NCBI-ProteinID: NP_851820
OMIM: 300336
HGNC: 14289
Ensembl: ENSG00000196338
Pharos: Q9NZ94(Tbio)
UniProt: Q9NZ94 X5DNV3
Position
X:71144841..71175307
AA seq 848 aa
MWLRLGPPSLSLSPKPTVGRSLCLTLWFLSLALRASTQAPAPTVNTHFGKLRGARVPLPS
EILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLP
VWFTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICRKGGSGAKKQG
EDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITLNYRVG
VLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLTLS
HHSEGLFQRAIIQSGSALSSWAVNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKEL
VEQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDP
EDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPETRRKTLVALFTD
HQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDAAHGDEVPYVFGVPMVGPTD
LFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRD
QLYLHIGLKPRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITR
RPNGKTWSTKRPAISPAYSNENAQGSWNGDQDAGPLLVENPRDYSTELSVTIAVGASLLF
LNVLAFAALYYRKDKRRQEPLRQPSPQRGAGAPELGAAPEEELAALQLGPTHHECEAGPP
HDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQTLHPYNTFAAGFNSTGLP
HSHSTTRV
NT seq 2547 nt   +upstreamnt  +downstreamnt
atgtggctgcggcttggcccgccctcgctgtccctgagccccaagcccacggttggcagg
agcctgtgcctcaccctgtggttcctcagtttggcgctgagggccagtacccaggcccca
gcacccacagtcaacactcactttgggaagctaaggggtgcccgagtaccactgcccagt
gagatcctggggcctgtggaccaatacctgggggtgccctacgcagctcccccgatcggc
gagaaacgtttcctgccccctgaaccacccccatcctggtcgggcatccggaacgccaca
cactttcccccagtgtgcccccagaacatccacacagctgtgcccgaagtcatgctgccg
gtctggttcactgccaacttggatatcgtcgctacttacatccaggagcccaacgaagac
tgtctctacctgaacgtctatgtgccgacggaggatgtaaagcggatttccaaggaatgc
gcccgaaagcccaacaagaaaatttgtaggaaaggaggatccggcgctaagaaacagggc
gaggacttagcggataatgacggggatgaagatgaagacatccgggacagtggtgctaaa
cccgtcatggtctacatccacggaggctcttacatggaagggacaggcaacatgattgat
ggcagcatcctcgccagttatggcaatgtcatcgtcatcaccctcaactatcgggttgga
gtgctaggtttcctgagtactggagatcaggctgccaagggcaactatgggctccttgac
cagatccaggccctccgctgggtgagcgagaatattgccttcttcgggggagacccccgc
cggatcactgtctttggctcgggcattggtgcatcctgcgtcagcctcctcacgttgtca
catcactcagagggacttttccagagagccatcatccaaagtggctctgctctgtccagc
tgggctgtgaactaccaaccagtgaagtacaccagcctgctggcagacaaagtgggctgt
aatgtgctggacaccgtggatatggtggactgtcttcggcaaaagagtgccaaggagctg
gtagagcaggacatccagccagcccgctaccacgtggcctttggccctgtgattgatggt
gatgtcattcctgatgaccctgagatcctcatggagcagggcgagttcctcaactatgac
atcatgctaggtgtcaaccagggcgagggtctcaagtttgtggaaggggtggtggaccct
gaggatggtgtctctggcactgactttgactattccgtctccaattttgtggacaatctg
tatggctatcctgagggtaaggacaccctgcgagagaccatcaagttcatgtatacagac
tgggcagaccgtgacaaccctgagacccgccgtaaaacactggtggcactcttcactgac
caccagtgggtggagccctcagtggtgacagccgatctgcatgcccgctacggctcgcct
acctacttctacgccttctatcatcactgccagagcctcatgaagcctgcttggtcagat
gcagctcatggggatgaagtaccctatgtttttggggttcctatggtaggccccactgac
cttttcccctgcaacttctccaagaatgatgttatgctcagtgctgtcgtcatgacctat
tggaccaactttgccaagactggggatcccaacaagccggtcccccaggacaccaagttc
attcacaccaaggccaaccgctttgaggaagtggcctggtccaaatacaatccccgagac
cagctctaccttcacatcgggctgaaaccaagggtccgagatcattaccgggccactaag
gtggccttttggaaacatctggtgccccacctatacaacctgcatgacatgttccactat
acgtccaccaccaccaaagtgccgcctccggataccacccacagctcccacatcacccgc
aggcccaatggcaagacctggagcaccaagcggccagccatctcacctgcctacagcaac
gagaatgcccaggggtcctggaacggggaccaggatgcagggccactcctggtggagaac
cctcgtgactactccactgaattaagtgtcaccatcgccgtgggggcctccctcctgttc
cttaacgttctggccttcgctgccctctactaccgtaaggacaaacggcgccaggagccc
ctgcggcagcctagccctcagcggggagccggggccccggagttgggagctgctccagag
gaggagctggcagcattacaactgggccccacccaccacgagtgtgaggccggtcccccc
catgacacgctgcgcctcactgcattgcccgactacaccctgaccctgcggcgctccccg
gatgacatcccactcatgacccccaacaccatcactatgatccccaactccctggtaggg
ctgcagacattgcacccctataacacctttgccgcagggttcaacagtaccgggctgccc
cactcacactccactacccgggtatag

DBGET integrated database retrieval system