KEGG   Homo sapiens (human): 54414
Entry
54414             CDS       T01001                                 

Gene name
SIAE, AIS6, CSE-C, CSEC, LSE, YSG2
Definition
(RefSeq) sialic acid acetylesterase
  KO
K05970  sialate O-acetylesterase [EC:3.1.1.53]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    54414 (SIAE)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.53  sialate O-acetylesterase
     54414 (SIAE)
SSDB
Motif
Pfam: SASA Big_6 DBD_Tnp_Mut
Other DBs
NCBI-GeneID: 54414
NCBI-ProteinID: NP_733746
OMIM: 610079
HGNC: 18187
Ensembl: ENSG00000110013
Vega: OTTHUMG00000165926
Pharos: Q9HAT2(Tbio)
UniProt: Q9HAT2
Position
11q24.2
AA seq 523 aa
MVAPGLVLGLVLPLILWADRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVT
LRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDV
WLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPT
SENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQ
GSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDW
RETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFM
AVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGL
LNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRY
AWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAK
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggtcgcgccggggcttgtactcgggctggtgctgccattaatcctgtgggccgacaga
agtgcaggtattggttttcgctttgcttcatacatcaataatgatatggtgctgcagaag
gagcctgctggggcagtgatatggggcttcggtacacctggagccacagtgaccgtgacc
ctgcgccaaggtcaggaaaccatcatgaagaaagtgaccagtgtgaaagctcactctgat
acgtggatggtggtactggatcctatgaagcctggaggacctttcgaagtgatggcacaa
cagactttggagaaaataaacttcaccctgagagttcatgacgtcctgtttggagatgtc
tggctctgtagtgggcagagtaacatgcagatgactgtgttacagatatttaatgctaca
agggagttgtctaacactgcggcatatcagtctgtccgcatcctctctgtctctcccatt
caagcagagcaggagctggaggaccttgttgcggttgacttgcagtggtctaagcccacc
tcagaaaacttaggccatggatatttcaagtacatgtcagcagtgtgctggctctttgga
cgtcacctttatgacactctgcagtatcccatcgggctgatcgcctccagctggggcggg
acacccattgaagcctggtcatctggacggtcactgaaagcctgtggggtccctaaacaa
gggtccattccatacgattctgtaactggtcccagtaagcactctgttctctggaatgcc
atgatccatccactgtgcaatatgactctgaaaggggtagtatggtaccagggggagtcc
aatataaattataacacggatctgtacaattgcacattccctgcactcatcgaagactgg
cgtgaaaccttccaccgtggttcccaggggcagacggagcgtttcttcccatttggactt
gtccagttatcttcagatttgtctaagaagagctcagacgatggatttccccagatccgt
tggcatcaaacagcagacttcggctatgtccccaacccaaagatgcccaatactttcatg
gctgtagctatggatctctgtgatagagactcgccttttggcagcatccaccctcgagat
aaacagactgtggcttatcggctgcatttgggggcccgtgctctggcttatggtgagaag
aatttgacctttgaaggaccactgcctgagaagatagaactcttggctcacaaggggctg
ctcaatctcacatattaccagcaaatccaggtgcagaaaaaggacaacaagatatttgag
atctcctgttgcagtgaccatcgatgcaagtggcttccagcttctatgaacaccgtctcc
acccagtccctgaccctggcgatcgattcttgtcatggcactgtggttgctctccgctat
gcttggaccacgtggccttgtgaatataagcagtgtcccctataccaccccagtagtgcc
ctgccagcccctcccttcattgctttcattacagaccagggtcctggacatcagagcaat
gttgctaaatga

DBGET integrated database retrieval system