KEGG   Homo sapiens (human): 5442Help
Entry
5442              CDS       T01001                                 

Gene name
POLRMT, APOLMT, MTRNAP, MTRPOL, h-mtRPOL
Definition
(RefSeq) RNA polymerase mitochondrial
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    5442 (POLRMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     5442 (POLRMT)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    5442 (POLRMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N PSD2 PPR_3 DUF615
Motif
Other DBs
NCBI-GeneID: 5442
NCBI-ProteinID: NP_005026
OMIM: 601778
HGNC: 9200
Ensembl: ENSG00000099821
Vega: OTTHUMG00000180611
Pharos: O00411(Tbio)
UniProt: O00411 Q4G0F4
Structure
PDB: 

Position
19p13.3
AA seq 1230 aa AA seqDB search
MSALCWGRGAAGLKRALRPCGRPGLPGKEGTAGGVCGPRRSSSASPQEQDQDRRKDWGHV
ELLEVLQARVRQLQAESVSEVVVNRVDVARLPECGSGDGSLQPPRKVQMGAKDATPVPCG
RWAKILEKDKRTQQMRMQRLKAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDCTR
QAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLP
LAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYA
AALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSL
PPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLHMELASRVCVVSVEKP
TLPSKEVKHARKTLKTLRDQWEKALCRALRETKNRLEREVYEGRFSLYPFLCLLDEREVV
RMLLQVLQALPAQGESFTTLARELSARTFSRHVVQRQRVSGQVQALQNHYRKYLCLLASD
AEVPEPCLPRQYWEELGAPEALREQPWPLPVQMELGKLLAEMLVQATQMPCSLDKPHRSS
RLVPVLYHVYSFRNVQQIGILKPHPAYVQLLEKAAEPTLTFEAVDVPMLCPPLPWTSPHS
GAFLLSPTKLMRTVEGATQHQELLETCPPTALHGALDALTQLGNCAWRVNGRVLDLVLQL
FQAKGCPQLGVPAPPSEAPQPPEAHLPHSAAPARKAELRRELAHCQKVAREMHSLRAEAL
YRLSLAQHLRDRVFWLPHNMDFRGRTYPCPPHFNHLGSDVARALLEFAQGRPLGPHGLDW
LKIHLVNLTGLKKREPLRKRLAFAEEVMDDILDSADQPLTGRKWWMGAEEPWQTLACCME
VANAVRASDPAAYVSHLPVHQDGSCNGLQHYAALGRDSVGAASVNLEPSDVPQDVYSGVA
AQVEVFRRQDAQRGMRVAQVLEGFITRKVVKQTVMTVVYGVTRYGGRLQIEKRLRELSDF
PQEFVWEASHYLVRQVFKSLQEMFSGTRAIQHWLTESARLISHMGSVVEWVTPLGVPVIQ
PYRLDSKVKQIGGGIQSITYTHNGDISRKPNTRKQKNGFPPNFIHSLDSSHMMLTALHCY
RKGLTFVSVHDCYWTHAADVSVMNQVCREQFVRLHSEPILQDLSRFLVKRFCSEPQKILE
ASQLKETLQAVPKPGAFDLEQVKRSTYFFS
NT seq 3693 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcactttgctggggccgcggagcggcggggctcaaacgagccctacggccttgc
ggccgcccgggactccccggcaaagaagggaccgccggtggcgtctgcggccccaggagg
agctcgtccgccagcccccaggagcaagaccaagaccgcaggaaggactggggccacgtg
gagctgctggaggtgctccaggcgcgggtgcggcagctgcaggctgagagcgtgtcggag
gtggtggtgaacagggtggatgtggcgcggctcccagaatgtggcagtggagatggtagc
ctccagccacccaggaaggtccagatgggggccaaggatgccaccccggtgccctgtggc
cgctgggcaaagatactggagaaggataagcggacccagcagatgcgtatgcagcggttg
aaggcgaagctgcagatgccattccagagcggggagttcaaggcgctgaccaggcgcctg
caggtggagccccggctcctgagcaagcagatggccgggtgcctggaggactgcacgcgc
caggcccccgagagcccctgggaggagcagctggcccggctgctgcaggaggcccctggg
aagctgagcctcgatgtggagcaggccccgtcggggcagcactcgcaggcccagctctca
ggtcagcagcagaggctcctggccttcttcaagtgctgcctgctcactgaccagctgccc
ctcgcccaccacctgctggtcgtccaccacggccagcggcagaagcggaagctgctcacg
ctggacatgtacaacgccgtgatgcttggctgggcgcggcagggtgccttcaaggagctg
gtatatgtgttattcatggtgaaggatgccggcttgactccggacctgctgtcctatgcg
gctgccctccagtgcatggggaggcaggaccaggacgccgggaccatcgaaaggtgtctg
gaacagatgagccaggaggggctgaagctgcaggcactcttcaccgccgttctgctgtct
gaggaggatcgggccactgttctgaaggccgtgcacaaggtgaagcccaccttcagcctc
ccgccgcagctgccgcccccggtcaacacctccaagctgctcagggacgtgtatgccaag
gatgggcgtgtgtcctacccgaagctgcacctgcccttgaagaccctgcagtgcctcttt
gagaagcagctccacatggagctggccagcagggtgtgcgtggtgtccgtggagaagccc
acgttgccaagcaaggaggtcaagcacgcgcggaagaccctgaagaccctgcgggaccaa
tgggagaaagcactgtgccgggcgctgcgggagaccaagaaccgcctagagcgcgaggtg
tacgagggccggttctcactttaccccttcctgtgcctgctggacgagcgcgaggtggtg
cggatgctcctgcaggtcctgcaggcgctgcccgcccaaggtgagtccttcaccaccctg
gcccgggagctgagtgcgcgcactttcagccggcacgtggtgcagaggcagcgggtcagt
ggccaggtgcaggcgctgcagaaccactacaggaagtacctctgcttgctggcctccgac
gccgaggtgcccgagccctgcctgccgcggcagtactgggaggagctgggggcgcccgag
gccctgcgggagcagccctggcccctgccagtgcagatggagctgggcaagctgctggcg
gagatgctggtgcaggctacgcagatgccatgcagcctggacaagccgcatcgttcctct
cggcttgtccccgtgctctaccacgtgtattccttccgcaacgtccagcagatcggcatc
ctgaagccgcacccggcctacgtgcagctgctggagaaggccgcggagcccacgctgacc
ttcgaggcggtggatgtacccatgctttgccccccgctgccctggacatcgccgcactct
ggtgctttcctgctcagccccaccaagctgatgcgcacggtggaaggcgccacgcagcac
caggagctgctggaaacctgcccgcccaccgcgctgcatggcgcactggacgccctcacc
caactgggcaactgcgcctggcgcgtcaacgggcgcgtgctggacctggtgctgcagctc
ttccaggccaagggctgcccccagctaggcgtgccggccccgccctccgaggcgccccag
ccgcccgaggcccacctgccgcacagcgccgcgcccgcccgcaaggccgagctgcgccgt
gagctggcgcactgccagaaggtggcccgggagatgcacagcctgcgggcggaggcgctg
taccgcctctcgctggcgcagcacctgcgggaccgcgtcttctggctgccgcacaacatg
gacttccgcggccgcacctacccctgcccgccgcacttcaaccacctgggcagcgacgtg
gcgcgggccctgctggagttcgcccagggccgcccgctcggcccgcacggcctggattgg
ctcaagatccacctggtcaatctcacggggttgaagaagcgggagccgctgcggaagcgc
ctggcctttgcggaggaggtgatggatgacatcctggactccgcggaccaacccttgacg
ggccgaaagtggtggatgggcgcggaggaaccctggcagacgctggcctgctgtatggag
gtggcgaacgctgtgcgcgcctccgaccctgccgcctatgtctcccacctccccgtccat
caggacggctcttgcaacggcctgcagcattatgctgctctgggccgcgacagcgtgggc
gccgcctccgtcaacctggagccctcggatgtgccgcaggacgtgtacagcggcgtggcc
gcgcaggtggaggtgttccgtaggcaggacgcccagcggggcatgcgggtggcacaggtg
ctggaaggtttcatcacccgcaaggtggtgaagcagacggtgatgacggtggtgtacggg
gtcacgcgctatggcgggcgcctgcagattgagaagcgcctccgggagctgagcgacttt
ccccaggagttcgtgtgggaggcctctcactatctcgtacgccaggtcttcaagagtcta
caggagatgttctcggggacccgggccatccagcactggctgaccgagagtgcccgcctc
atctcccacatgggctctgtggtggagtgggtcacacccctgggcgtccccgtcatccag
ccctatcgcctggactccaaggtcaagcaaataggaggtggaattcagagcatcacctac
acccacaacggagacatcagccgaaagcccaacacacgtaagcagaagaacggcttcccg
cccaacttcatccactcgctggactcctcccacatgatgctcaccgccctgcactgctac
aggaagggcctgaccttcgtctctgtgcacgactgttactggactcacgcagctgatgtc
tccgtcatgaaccaggtgtgccgggagcagtttgtccgcttgcacagcgagcccatcctg
caggacctgtccagattcctggtcaagcggttctgctctgagccccagaagatcttggag
gccagccagctgaaggagacactgcaggcggtgcccaagccaggggccttcgacctggag
caggtgaagcgttccacctacttcttcagctga

DBGET integrated database retrieval system