KEGG   Homo sapiens (human): 54431Help
Entry
54431             CDS       T01001                                 

Gene name
DNAJC10, ERdj5, JPDI, MTHr, PDIA19
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C10
  KO
K09530  DnaJ homolog subfamily C member 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    54431 (DNAJC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    54431 (DNAJC10)
   04131 Membrane trafficking [BR:hsa04131]
    54431 (DNAJC10)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   54431 (DNAJC10)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    54431 (DNAJC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin DnaJ Thioredoxin_2 OST3_OST6 Thioredoxin_6 Thioredoxin_8 Thioredoxin_7 AhpC-TSA Redoxin TraF RMMBL
Motif
Other DBs
NCBI-GeneID: 54431
NCBI-ProteinID: NP_061854
OMIM: 607987
HGNC: 24637
Ensembl: ENSG00000077232
Vega: OTTHUMG00000154209
Pharos: Q8IXB1(Tbio)
UniProt: Q8IXB1
Position
2q32.1
AA seq 793 aa AA seqDB search
MGVWLNKDDYIRDLKRIILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLAL
KLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWNYYRY
DFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEVDGLLR
IGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSFAMQHVRSTVTEL
WTGNFVNSIQTAFAAGIGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCATQDNL
CKSLDITTSTTAYFPPGATLNNKEKNSILFLNSLDAKEIYLEVIHNLPDFELLSANTLED
RLAHHRWLLFFHFGKNENSNDPELKKLKTLLKNDHIQVGRFDCSSAPDICSNLYVFQPSL
AVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDFFAPWC
PPCRALLPELRRASNLLYGQLKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGH
HSAEQILEFIEDLMNPSVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKR
MARTLTGLINVGSIDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYHYHSYNGWNRDAYSL
RIWGLGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLARMIKGK
VKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLE
TLRNQGKRNKDEL
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgggagtctggttaaataaagatgactatatcagagacttgaaaaggatcattctctgt
tttctgatagtgtatatggccattttagtgggcacagatcaggatttttacagtttactt
ggagtgtccaaaactgcaagcagtagagaaataagacaagctttcaagaaattggcattg
aagttacatcctgataaaaacccgaataacccaaatgcacatggcgattttttaaaaata
aatagagcatatgaagtactcaaagatgaagatctacggaaaaagtatgacaaatatgga
gaaaagggacttgaggataatcaaggtggccagtatgaaagctggaactattatcgttat
gattttggtatttatgatgatgatcctgaaatcataacattggaaagaagagaatttgat
gctgctgttaattctggagaactgtggtttgtaaatttttactccccaggctgttcacac
tgccatgatttagctcccacatggagagactttgctaaagaagtggatgggttacttcga
attggagctgttaactgtggtgatgatagaatgctttgccgaatgaaaggagtcaacagc
tatcccagcctcttcatttttcggtctggaatggccccagtgaaatatcatggagacaga
tcaaaggagagtttagtgagttttgcaatgcagcatgttagaagtacagtgacagaactt
tggacaggaaattttgtcaactccatacaaactgcttttgctgctggtattggctggctg
atcactttttgttcaaaaggaggagattgtttgacttcacagacacgactcaggcttagt
ggcatgttggatggtcttgttaatgtaggatggatggactgtgccacccaggataacctt
tgtaaaagcttagatattacaacaagtactactgcttattttcctcctggagccacttta
aataacaaagagaaaaacagtattttgtttctcaactcattggatgctaaagaaatatat
ttggaagtaatacataatcttccagattttgaactactttcggcaaacacactagaggat
cgtttggctcatcatcggtggctgttattttttcattttggaaaaaatgaaaattcaaat
gatcctgagctgaaaaaactaaaaactctacttaaaaatgatcatattcaagttggcagg
tttgactgttcctctgcaccagacatctgtagtaatctgtatgtttttcagccgtctcta
gcagtatttaaaggacaaggaaccaaagaatatgaaattcatcatggaaagaagattcta
tatgatatacttgcctttgccaaagaaagtgtgaattctcatgttaccacgcttggacct
caaaattttcctgccaatgacaaagaaccatggcttgttgatttctttgccccctggtgt
ccaccatgtcgagctttactaccagagttacgaagagcatcaaatcttctttatggtcag
cttaagtttggtacactagattgtacagttcatgagggactctgtaacatgtataacatt
caggcttatccaacaacagtggtattcaaccagtccaacattcatgagtatgaaggacat
cactctgctgaacaaatcttggagttcatagaggatcttatgaatccttcagtggtctcc
cttacacccaccaccttcaacgaactagttacacaaagaaaacacaacgaagtctggatg
gttgatttctattctccgtggtgtcatccttgccaagtcttaatgccagaatggaaaaga
atggcccggacattaactggactgatcaacgtgggcagtatagattgccaacagtatcat
tctttttgtgcccaggaaaacgttcaaagataccctgagataagattttttcccccaaaa
tcaaataaagcttatcattatcacagttacaatggttggaatagggatgcttattccctg
agaatctggggtctaggatttttacctcaagtatccacagatctaacacctcagactttc
agtgaaaaagttctacaagggaaaaatcattgggtgattgatttctatgctccttggtgt
ggaccttgccagaattttgctccagaatttgagctcttggctaggatgattaaaggaaaa
gtgaaagctggaaaagtagactgtcaggcttatgctcagacatgccagaaagctgggatc
agggcctatccaactgttaaattttatttctacgaaagagcaaagagaaattttcaagaa
gagcagataaataccagagatgcaaaagcaatcgctgccttaataagtgaaaaattggaa
actctccgaaatcaaggcaagaggaataaggatgaactttga

DBGET integrated database retrieval system