KEGG   Homo sapiens (human): 54436
Entry
54436             CDS       T01001                                 

Gene name
SH3TC1
Definition
(RefSeq) SH3 domain and tetratricopeptide repeats 1
  KO
K24313  SH3 domain and tetratricopeptide repeat-containing protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    54436 (SH3TC1)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    54436 (SH3TC1)
SSDB
Motif
Pfam: TPR_12 TPR_8 TPR_7 TPR_1 TPR_2 SH3_1 SH3_2 Csd3_N TPR_19
Other DBs
NCBI-GeneID: 54436
NCBI-ProteinID: NP_061859
HGNC: 26009
Ensembl: ENSG00000125089
Vega: OTTHUMG00000160934
Pharos: Q8TE82(Tdark)
UniProt: Q8TE82 B3KWX8
Position
4p16.1
AA seq 1336 aa
MENLPAVTTEEPTPMGRGPVGPSGGGSTRDQVRTVVMRPSVSWEKAGPEEAKAPVRGDEA
PPARVAGPAAGTPPCQMGVYPTDLTLQLLAVRRKSRLRDPGLQQTLRGQLRLLENDSREM
ARVLGELSARLLSIHSDQDRIVVTFKTFEEIWKFSTYHALGFTHHCLANLLMDQAFWLLL
PSEEEETAIQVHVDENALRLTHESLLIQEGPFFVLCPDHHVRVMTGPRDAGNGPQALRQA
SGAPQGEAAPETDSSPPSPSVSSEEVAVAAAPEPLIPFHQWALRIPQDPIDDAMGGPVMP
GNPLMAVGLASALADFQGSGPEEMTFRGGDLIEILGAQVPSLPWCVGRHAASGRVGFVRS
SLISMQGPVSELESAIFLNEEEKSFFSEGCFSEEDARQLLRRMSGTDVCSVYSLDSVEEA
ETEQPQEKEIPPPCLSLEPQETLQKVKNVLEQCKTCPGCPQEPASWGLCAASSDVSLQDP
EEPSFCLEAEDDWEDPEALSSLLLFLNAPGYKASFRGLYDVALPWLSSVFRSFSDEEELT
GRLAQARGAAKKAGLLMALARLCFLLGRLCSRRLKLSQARVYFEEALGALEGSFGDLFLV
VAVYANLASIYRKQKNREKCAQVVPKAMALLLGTPDHICSTEAEGELLQLALRRAVGGQS
LQAEARACFLLARHHVHLKQPEEALPFLERLLLLHRDSGAPEAAWLSDCYLLLADIYSRK
CLPHLVLSCVKVASLRTRGSLAGSLRSVNLVLQNAPQPHSLPAQTSHYLRQALASLTPGT
GQALRGPLYTSLAQLYSHHGCHGPAITFMTQAVEASAIAGVRAIVDHLVALAWLHVLHGQ
SPVALDILQSVRDAVVASEDQEGVIANMVAVALKRTGRTRQAAESYYRALRVARDLGQQR
NQAVGLANFGALCLHAGASRLAQHYLLEAVRLFSRLPLGECGRDFTHVLLQLGHLCTRQG
PAQQGKGYYEWALLVAVEMGHVESQLRAVQRLCHFYSAVMPSEAQCVIYHELQLSLACKV
ADKVLEGQLLETISQLYLSLGTERAYKSALDYTKRSLGIFIDLQKKEKEAHAWLQAGKIY
YILRQSELVDLYIQVAQNVALYTGDPNLGLELFEAAGDIFFDGAWEREKAVSFYRDRALP
LAVTTGNRKAELRLCNKLVALLATLEEPQEGLEFAHMALALSITLGDRLNERVAYHRLAA
LQHRLGHGELAEHFYLKALSLCNSPLEFDEETLYYVKVYLVLGDIIFYDLKDPFDAAGYY
QLALAAAVDLGNKKAQLKIYTRLATIYHNFLLDREKSLFFYQKARTFATELNVRRVNLPP
LPLCGWAPWLAPSHPR
NT seq 4011 nt   +upstreamnt  +downstreamnt
atggagaacctccctgccgtgaccactgaggagccgacccccatggggaggggtcctgtg
ggaccctcaggaggtggcagcacccgggaccaggtccggactgtggtcatgaggccctct
gtgagctgggagaaagcggggcccgaggaggccaaggcgccagtgagaggcgacgaggct
cctcctgcccgcgtggctgggcctgctgctgggacccctccctgccagatgggggtttat
cccacagacctgaccctgcagctgctggctgtgcggaggaagagcagactgcgggacccc
ggcctacagcagaccctccggggccagctccgcctgctggagaatgatagccgggagatg
gcccgcgtgcttggggaattatcagccaggctgctgtccatccacagtgaccaggaccgg
atcgtggtgacgtttaagacttttgaagaaatctggaagttttccacctaccatgctctc
ggcttcactcatcactgcctggcaaacctgctcatggaccaggccttctggctgctcttg
cccagtgaggaggaggagacggccatccaagtccatgtggatgagaacgccttaaggctg
acccacgagagcctcctcatccaagaagggcccttctttgtcctgtgtcctgaccaccat
gtgagagtgatgacgggtccccgggatgcaggaaatggcccccaggccctcaggcaggct
tcgggggcaccccagggagaggcggccccggaaacagactcttcaccgccgagccccagc
gtgtcctccgaggaggtggcagtggcggccgccccggagcctttgattccatttcatcag
tgggctcttaggatcccccaggaccccatcgacgatgccatgggtggccctgtgatgccc
ggcaacccgctgatggctgtgggcctggcctcggcattggcagacttccagggctcgggg
cccgaagagatgaccttccgaggtggcgacctcatcgagatccttggggcgcaggtgccc
agcctgccctggtgcgtgggccgacacgcagcctcgggccgggtggggtttgtgcggagc
agcctcatcagcatgcagggccccgtgtccgagttggaaagtgcgatttttctcaatgag
gaagaaaagtcattcttcagcgagggctgcttttctgaggaggatgccaggcagttgctg
aggcggatgtcgggcaccgatgtctgcagcgtgtacagcctggactcagtagaggaagct
gagaccgagcagccgcaggaaaaagaaatacctccaccttgcctgagcctggagccacag
gagaccttgcagaaggtgaagaatgttctggaacaatgcaagacctgcccaggctgcccc
caggagccagcgtcctggggtctctgtgcggcatccagcgacgtgagcttgcaggacccc
gaggagccctccttctgcttggaagccgaggacgactgggaggacccagaggccctgagc
tcactgctgctgttcctgaacgcccctgggtacaaggccagcttccgtggcctgtacgat
gtggcgctgccgtggctgagcagcgtgttccgcagcttcagcgacgaggaggagctgact
gggcgcctggcacaggcccggggggcggccaagaaagctggcctcctcatggccctggcc
aggctctgcttcctcctggggcggctgtgcagcaggaggctcaagctgtcccaggcccgg
gtgtactttgaggaagcgctgggggccctggagggcagcttcggggacctgttcctagtg
gtggctgtgtacgccaacctggccagcatttaccggaagcagaagaaccgggagaagtgt
gcacaggtggtgcccaaagccatggccctgctcctggggacgcctgaccacatctgcagc
accgaggcggagggggagctcctgcagctggcgctgcggcgggcggtgggtggccagagc
ctgcaggccgaggcccgggcctgcttcctgctggccaggcaccacgtgcacctcaagcag
cccgaggaggccctgcccttcctagagcggctgctgcttttgcacagggactcgggagcc
ccagaggccgcgtggctctcagactgctacctactcctggctgacatctacagccgcaag
tgcctgccccacctggtgctgagctgtgtcaaggtggcctcattgcggacacggggctcg
ctggccggctcgctgaggagtgtgaacctggtgctccagaacgccccccagccccacagc
ctccctgcccaaacttcccactacctcaggcaagcgctggcctccctgaccccgggcaca
ggccaggcgctgcgcggccccctctacaccagcttggcccagctgtacagccaccatggc
tgccacggcccggccatcaccttcatgacgcaggcagtggaagccagtgctattgccgga
gtccgtgccatcgtggaccacctggtggccctggcctggctgcacgtgcttcatgggcag
agcccggtggccctggacatcctgcagtctgtccgggatgcagtggtggccagcgaggac
caggagggcgtgattgccaacatggtggccgtggctctgaagaggacgggccggacgagg
caggcagctgagagctactaccgcgccctgcgggtggctcgggacctgggccagcaaagg
aaccaggcagtggggctggccaacttcggggccctgtgcctgcatgcgggtgccagcagg
ctggcccagcactacctcctggaggccgtgcggctgttctcgaggctgccccttggggag
tgtggccgggacttcacccacgtgctcctgcagctgggccatctctgcacccgccagggc
ccggcccagcagggcaagggctactacgagtgggcccttctggtcgccgtggagatgggc
cacgtggagagccagctgcgggccgtccagcggctgtgccacttctacagcgccgtcatg
cccagcgaggcccagtgtgtcatctaccatgagctccagctctccctggcctgcaaggtg
gccgacaaggtgctggaggggcagctcctggagaccatcagccagctctacctgtccctg
ggcaccgagcgggcctacaaatccgcactggactacaccaaacgaagtctggggattttc
attgacctccagaagaaagagaaggaggcgcatgcctggctgcaagcagggaagatctat
tacatcttgcggcagagcgagctggtggacctctacatccaggtggcacagaacgtggcc
ctgtacacaggcgaccccaacctggggctggagctgtttgaggcggctggagacatcttc
ttcgacggggcctgggagcgggagaaagctgtgtccttctaccgggaccgggccctgccc
ctggcagtgactacgggcaaccgcaaggcggagctgcggctgtgcaacaagctggtggca
ctgctggccacgctggaggagccccaggagggcttggagtttgcccacatggccctagca
ctcagcatcaccctgggggaccggctgaacgagcgcgtggcctaccaccggctggccgcc
ctgcaacaccgactgggccatggcgagctggcagagcacttctacctcaaggccctgtcg
ctctgcaactcgccgctggagtttgacgaggagaccctctactacgtgaaggtgtacctg
gtgctcggtgacatcatcttctacgacctgaaggacccgtttgatgcagccgggtactac
cagctggcgctggcagccgccgtggacctgggcaacaagaaggcacagctgaagatctac
acgcggctggccaccatctaccacaacttcctcctggaccgtgagaagtcgctcttcttc
taccagaaggccaggaccttcgccacagagctcaacgtccgcagggtcaacctgcctcct
ctgccactctgcgggtgggccccctggttggcccccagccaccctcgctga

DBGET integrated database retrieval system