KEGG   Homo sapiens (human): 54440Help
Entry
54440             CDS       T01001                                 

Gene name
SASH3, 753P9, CXorf9, HACS2, SH3D6C, SLY
Definition
(RefSeq) SAM and SH3 domain containing 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SLY SAM_1 SAM_2 SH3_2 SH3_1 SH3_9
Motif
Other DBs
NCBI-GeneID: 54440
NCBI-ProteinID: NP_061863
OMIM: 300441
HGNC: 15975
Ensembl: ENSG00000122122
Vega: OTTHUMG00000022372
Pharos: O75995(Tdark)
UniProt: O75995
Position
Xq26.1
AA seq 380 aa AA seqDB search
MLRRKPSNASEKEPTQKKKLSLQRSSSFKDFAKSKPSSPVVSEKEFNLDDNIPEDDSGVP
TPEDAGKSGKKLGKKWRAVISRTMNRKMGKMMVKALSEEMADTLEEGSASPTSPDYSLDS
PGPEKMALAFSEQEEHELPVLSRQASTGSELCSPSPGSGSFGEEPPAPQYTGPFCGRARV
HTDFTPSPYDHDSLKLQKGDVIQIIEKPPVGTWLGLLNGKVGSFKFIYVDVLPEEAVGHA
RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDP
QHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRD
DAELAGTEEQLQGLSLAGAP
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcaagccctccaatgccagtgagaaggagcccactcagaagaaaaagctc
tcccttcagcgctccagcagcttcaaggattttgccaaatccaaacccagctcccccgtg
gtgagcgagaaggagtttaatctggatgataacattccagaagatgactcaggtgtcccc
accccagaagatgctgggaagagtggcaaaaagctggggaagaagtggagggcagtgatt
tcccgaaccatgaacaggaagatgggcaagatgatggtgaaggccctgtcagaagagatg
gcagacactctggaggagggctctgcctccccgacatctccagactacagcctggacagc
cctggccctgagaagatggcgctggccttttctgagcaagaggagcatgaacttccggtg
ctcagccgccaggcatcaacaggcagtgagctctgcagccccagcccaggttctggcagc
ttcggggaggaaccacctgccccccagtacacagggcctttctgtggccgggcacgagtc
cacaccgacttcactcccagcccctatgaccacgactcgctgaaactgcagaaaggagat
gtgatccagatcattgaaaagccacctgtgggcacgtggctgggcctactcaatggcaag
gtgggctctttcaaattcatctatgtggatgtgctgcccgaggaggccgtggggcatgcc
cgccccagccgccgacagagcaagggcaagaggcccaagcctaagaccctgcatgagctg
ctggagcgcatcggcctggaggagcacacatccaccctcctgctcaatggctaccagaca
ctggaagacttcaaagagctgcgagaaacacacctcaatgagctgaacatcatggatcca
cagcaccgggccaagctgctcacggccgccgagctgctgctggactatgacactggcagt
gaggaggctgaagagggcgccgagagcagccaggagccagtggcacacacagtgtcggaa
cccaaggtggacatcccgcgcgactcaggctgctttgagggctcggagagcgggcgcgat
gacgcagagctggcaggcactgaggagcagctgcaaggcctctccctggccggggcacct
tga

DBGET integrated database retrieval system