KEGG   Homo sapiens (human): 54456
Entry
54456             CDS       T01001                                 

Gene name
MOV10L1, CHAMP, DJ402G11.8
Definition
(RefSeq) Mov10 like RISC complex RNA helicase 1
  KO
K13983  putative helicase MOV10L1 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54456 (MOV10L1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     54456 (MOV10L1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    54456 (MOV10L1)
SSDB
Motif
Pfam: AAA_12 AAA_11 S1-like AAA_30 AAA_19 ResIII AAA AAA_22
Other DBs
NCBI-GeneID: 54456
NCBI-ProteinID: NP_061868
OMIM: 605794
HGNC: 7201
Ensembl: ENSG00000073146
Vega: OTTHUMG00000044648
Pharos: Q9BXT6(Tbio)
UniProt: Q9BXT6
Position
22q13.33
AA seq 1211 aa
MLSLAAKLVAFFWRTADTPREEAGQLEPELAEGDTKLKTVRGVVTRYCSDYGMIDDMIYF
SSDAVTSRVLLNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL
IGCVTSLVEGAGCISQTTYFSLESVCEGFEPCKGDWVEAEYRIRPGTWSSEATSVKPLRY
KRVDKVCISSLCGRNGVLEESIFFTLDSLKLPDGYTPRRGDVVNAVVVESSQSCYVWRAL
CMTLVKRRDAAPVHEATHFYGTILLKNKGDIEVTQVTHFGTLKEGRSKTMVIWIENKGDI
PQNLVSCKLAGWDKSKQFRFQMLDKDQMCPVVSFVSVPEKENSSDENINSLNSHTKNKTS
QMSESSLVNNRGISPGDCTCKGENGEKDNILSRKQMTEPEPGGLVPPGGKTFIVVICDGK
NPGRCKELLLLCFSDFLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVV
TAQKRNSRRQLPSFLPQYPIPDRLRKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWL
EEIYAEMELKEYNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGHAIEY
ISYVTEIHEEDVTLKINPEFEQAYNFEPMDVEFTYNRTTSRRCHFALEHVIHLGVKVLFP
EEIILQSPQVTGNWNHAQDTKSSGQSTSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFT
AEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPYILFGPPGTGKTVTI
IEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRFEEIVIDA
VKPYCRDGEDIWKASRFRIIITTCSSSGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPL
GLMSDISGQIVLAGDPMQLGPVIKSRLAMAYGLNVSFLERLMSRPAYQRDENAFGACGAH
NPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHG
VRGSEAREGKSPSWFNPAEAVQVLRYCCLLAHSISSQVSASDIGVITPYRKQVEKIRILL
RNVDLMDIKVGSVEEFQGQEYLVIIISTVRSNEDRFEDDRYFLGFLSNSKRFNVAITRPK
ALLIVLGNPHVLVRDPCFGALLEYSITNGVYMGCDLPPALQSLQNCGEGVADPSYPVVPE
STGPEKHQEPS
NT seq 3636 nt   +upstreamnt  +downstreamnt
atgctgagcctcgcagccaagctggtggccttcttctggaggacggcggacacccctagg
gaggaagccgggcagctggagcccgagctcgcggaaggtgacactaagctgaaaactgta
cggggtgtcgtgacaaggtactgcagcgattatggcatgattgatgatatgatctacttc
tccagtgatgctgtgactagcagagtgcttctgaatgttggacaggaagtgattgcagtt
gtggaagaaaataaagtgtccaatggactgaaagcaatcagggtagaagctgtctctgat
aagtgggaagacgacagcagaaaccatgggagtccctcagactgcggcccccgagtgttg
attggctgtgtgacttccctggtggagggcgcaggctgtatcagtcagaccacctacttc
tctctggagagtgtgtgcgaaggcttcgagccctgcaagggagactgggtggaggctgag
taccggatccggcctggcacgtggagcagcgaagccacctcagtgaagccactgagatac
aagcgcgtggacaaggtctgcatctctagcctctgtggaaggaacggggtgttagaggaa
agcatcttctttaccttggactccttgaaactgccagatgggtacacaccccggagaggt
gacgtggtcaatgcagtggtggtggagagcagccagtcatgctatgtctggagggcactt
tgtatgaccctagtgaagaggcgagacgccgcccctgttcatgaggccactcatttctat
ggaacgattttgctgaagaacaaaggtgatattgaagttacacaggtgacgcattttgga
accctaaaggaaggaagaagtaaaaccatggtgatctggatagagaataaaggagacatt
cctcaaaacttagtcagctgtaaactggctggctgggataaatctaaacaattcagattc
caaatgctggataaagaccagatgtgccccgtggtatcttttgtttctgttcctgagaag
gagaattcatcagatgaaaatattaattcattaaatagccacacaaaaaacaaaacctct
cagatgtcggagagcagtttggtgaacaacagaggaatctctccaggtgattgtacctgt
aaaggagaaaatggagaaaaagacaacattctatcaaggaagcagatgacagagcctgag
cctggggggcttgtccctccagggggaaaaaccttcattgtggtcatctgtgacggaaaa
aatcctggccgctgcaaggagctccttttgctctgtttttccgatttcctaattgggcga
taccttgaagtaaatgttatcagtggggaggagtcactaattgctgcgcgcgaaccattt
tcttggaaaaagcttaaaagttcacaagcgttaacatccgcaaaaactacagttgttgtg
accgcacagaaaaggaactcaagacgacaacttccaagttttcttccccaatatccaatc
ccagatagacttagaaaatgtgtggaacaaaaaattgacatcctgactttccagccatta
cttgcagagcttctgaacatgtcaaattacaaggagaagttttcgactttgctgtggctt
gaggagatttatgcagaaatggaactgaaagagtataacatgagcgggatcatcttaaga
aggaatggggatctgctggttctggaggtcccagggttggccgaagggaggccttctctc
tacgcaggtgataaactgattttaaaaactcaagagtacaatggacatgccatcgaatac
atcagctacgtgactgagattcatgaagaagatgtaactcttaaaattaatccagaattt
gaacaagcctataactttgaacctatggatgtggaatttacatataataggaccacaagc
agacggtgtcactttgcacttgaacacgtcatccacttaggtgtaaaagtgttgtttcca
gaagaaattattttacagtctccacaagtgacgggaaattggaaccatgcacaagacacc
aaaagcagtggacagtccaccagcaaaaagaataggaaaacaatgacggaccaagctgag
catggaacagaggagaggcgtgttggtgacaaggacctgccggtgctggcaccctttact
gcagagatgagcgattgggtagatgaaattcagacccctaaagcaagaaagatggagttt
ttcaacccagtgctaaatgaaaatcagaagttagcagttaaaaggattctgagtggtgac
tgccgtcccctcccgtatattctctttggacctcctggtactggaaagacagtgacaata
atagaggctgttttacaggtacactttgccttgccggacagtcggattttagtctgtgcg
ccctccaacagtgctgctgacctcgtgtgtctgcggctgcacgagagcaaggtgctacag
ccggccaccatggtccgggtgaacgccacctgcaggttcgaggagatagttattgacgcc
gtcaaaccgtattgcagagacggagaagacatctggaaagcctcacgcttccggataatc
atcaccacatgcagcagctcagggctgttttaccaaataggagtgagagttgggcacttc
actcacgtgtttgtggacgaggctgggcaggcaagtgagccggaatgcctcattcctctg
gggctgatgtcggacatcagtggccagatcgtgctggcaggagaccccatgcagctcggc
ccagtcattaagtccagactcgccatggcctatgggctgaacgtgtcctttttggaacgg
ctgatgtctcgacccgcgtaccagagggacgaaaatgctttcggtgcttgtggcgcacat
aatcccctgttggtcacaaagctggtgaagaactaccggtcccacgaggccctgctgatg
ctgccctcacggctgttctaccacagggaactcgaggtctgtgcggaccccacagtggtg
acctccttgctgggctgggagaagttgcctaagaaaggcttccctctcatcttccatggt
gtgcggggcagcgaggcacgggagggaaaaagcccatcgtggttcaacccggccgaggcc
gtccaggtcctgcgctactgctgcctcctggcccacagcatctccagtcaggtgtctgcc
agcgacattggcgtcatcacgccctaccggaagcaggtggagaaaatcagaattcttttg
cgtaatgttgatctgatggatataaaggttggatcagtagaggagtttcaaggacaagag
tatctggtcatcatcatttcgaccgtacggtcaaatgaagatagatttgaagatgatcga
tattttttgggtttcttgtccaactcaaaaagatttaatgttgcaatcaccagacccaaa
gctttgctgatagtgctgggaaacccccatgttctcgttcgagacccctgttttggtgct
ttgctggaatacagtattacaaacggtgtttacatgggatgcgatttacctcctgcactg
cagtctctgcaaaactgtggcgagggggtggcagacccctcctacccagtggtgccagaa
tccacaggaccagagaagcatcaggagcccagctga

DBGET integrated database retrieval system