KEGG   Homo sapiens (human): 54468
Entry
54468             CDS       T01001                                 

Gene name
MIOS, MIO, Sea4, Yulink
Definition
(RefSeq) meiosis regulator for oocyte development
  KO
K20407  WD repeat-containing protein mio
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    54468 (MIOS)
SSDB
Motif
Pfam: zinc_ribbon_16
Other DBs
NCBI-GeneID: 54468
NCBI-ProteinID: NP_061878
OMIM: 615359
HGNC: 21905
Ensembl: ENSG00000164654
Vega: OTTHUMG00000152440
Pharos: Q9NXC5(Tdark)
UniProt: Q9NXC5 A0A024RA24
Position
7p21.3
AA seq 875 aa
MSGTKPDILWAPHHVDRFVVCDSELSLYHVESTVNSELKAGSLRLSEDSAATLLSINSDT
PYMKCVAWYLNYDPECLLAVGQANGRVVLTSLGQDHNSKFKDLIGKEFVPKHARQCNTLA
WNPLDSNWLAAGLDKHRADFSVLIWDICSKYTPDIVPMEKVKLSAGETETTLLVTKPLYE
LGQNDACLSLCWLPRDQKLLLAGMHRNLAIFDLRNTSQKMFVNTKAVQGVTVDPYFHDRV
ASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTKVAWCPTRTGLLATLTRDSNIIRLYDMQH
TPTPIGDETEPTIIERSVQPCDNYIASFAWHPTSQNRMIVVTPNRTMSDFTVFERISLAW
SPITSLMWACGRHLYECTEEENDNSLEKDIATKMRLRALSRYGLDTEQVWRNHILAGNED
PQLKSLWYTLHFMKQYTEDMDQKSPGNKGSLVYAGIKSIVKSSLGMVESSRHNWSGLDKQ
SDIQNLNEERILALQLCGWIKKGTDVDVGPFLNSLVQEGEWERAAAVALFNLDIRRAIQI
LNEGASSEKGDLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSETG
SYDGVLYENKVAVRDRVAFACKFLSDTQLNRYIEKLTNEMKEAGNLEGILLTGLTKDGVD
LMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENYRNLLDAWRFWHKRAEFDIHR
SKLDPSSKPLAQVFVSCNFCGKSISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRK
PLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHML
SWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgagcggtaccaaacctgatattttatgggcaccacaccatgttgatagatttgttgtg
tgtgactcagaactaagtctttatcatgtggaatctactgtgaattcagaactcaaagct
ggatctttacgtttatctgaagactctgcagctacattactgtcaataaattcagataca
ccctatatgaaatgtgttgcctggtatcttaattatgatcctgaatgtctgctggcagtt
ggacaagcaaatggtcgagttgtacttacaagccttggtcaagatcataactcaaagttc
aaagatttgataggaaaagagtttgttccaaaacatgcacgacaatgtaatacccttgcc
tggaatccactggatagtaactggctagctgctggtttagataagcacagagctgacttt
tcagtgctaatatgggatatctgcagcaaatatactcctgatatagttcccatggaaaaa
gtgaaactttcagcaggtgaaactgaaacaacattattagtaacaaaaccactttatgag
ttaggacagaatgatgcttgtctgtctctttgttggcttccacgagaccagaaacttctc
cttgctggtatgcatcgtaacctagctatatttgatcttcggaatacaagccaaaagatg
ttcgtaaatacaaaagctgttcagggtgtgacggtagacccatatttccacgatcgtgtt
gcttccttctatgaaggtcaggttgcaatatgggatcttagaaaatttgagaagccagtt
ttgacattgactgagcaaccaaaacccttaacaaaagtagcatggtgtcccactaggact
ggtctacttgccactttaacaagggatagtaatattattagattgtatgatatgcagcat
acacccactcccattggggatgaaactgaacccacaataattgaaagaagtgtgcaacct
tgtgacaattacattgcttcctttgcgtggcatccaacaagtcaaaatcgaatgatagtt
gtaactcccaaccgaacaatgtcagacttcactgtttttgaaaggatatctcttgcctgg
agcccaattacatctttaatgtgggcttgtggtcgtcatttatatgaatgtacggaagaa
gaaaatgataattctttagaaaaagatatagcaacgaagatgcgtcttcgggctttatca
aggtatggacttgatacagagcaggtgtggaggaaccacattttagctggaaatgaagat
ccacagctcaagtcactctggtatactctgcactttatgaagcaatacacagaagatatg
gatcagaaatctccaggcaacaaaggatcattggtttatgcaggaattaaatcaattgta
aagtcatcgttgggaatggtggaaagcagcagacataattggagtgggttggataagcaa
agtgatattcaaaatttaaatgaagagagaatcttagctttacagctttgtgggtggata
aagaaaggaacggatgtagacgtggggccatttttgaactcccttgtacaagaaggggaa
tgggaaagagctgctgctgtggcattgttcaacttggatattcgccgagcaatccaaatc
ctgaatgaaggggcatcttctgaaaaaggagatctgaatctcaatgtggtagcaatggct
ttatcgggttatacggatgagaagaactccctttggagagaaatgtgtagcacactgcga
ttacagctaaataacccgtatttgtgtgtcatgtttgcatttctgacaagtgaaacagga
tcttacgatggagttttgtatgaaaacaaagttgcagtacgtgacagagtggcatttgct
tgtaaattccttagtgatactcagttaaatagatacatcgaaaagttgaccaatgaaatg
aaagaggctggaaatttggaaggaattttgcttacaggccttactaaagatggagtggac
ttaatggagagttatgttgatagaactggagatgttcaaacagcaagttactgtatgtta
cagggttcacctttagatgttcttaaagatgaaagggttcagtactggattgagaattat
agaaatttattagatgcctggaggttttggcataaacgagctgaatttgatattcacagg
agtaagttggatcccagttccaagcctttagcacaagtttttgtgagttgcaatttctgt
ggcaagtcaatctcctacagctgttcagctgtgcctcatcagggcagaggttttagtcag
tatggtgtgagtggctcaccaacgaaatctaaagtcacaagttgtcctggctgtcgaaaa
ccacttcctcgatgtgcgctttgtctcattaatatgggaacaccagtttctagctgtcct
ggaggaaccaaatcagatgaaaaagtggacttgagcaaggacaaaaaattagcccaattt
aacaactggtttacatggtgtcataattgcaggcacggtggacatgctggacatatgctt
agttggttcagggaccatgcagagtgccctgtgtcggcatgcacgtgtaaatgtatgcag
ttggatacaacagggaatctggtacctgcagagactgtccagccataa

KEGG   Homo sapiens (human): 6396
Entry
6396              CDS       T01001                                 

Gene name
SEC13, D3S1231E, SEC13L1, SEC13R, npp-20
Definition
(RefSeq) SEC13 homolog, nuclear pore and COPII coat complex component
  KO
K14004  protein transport protein SEC13
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa04141  Protein processing in endoplasmic reticulum
hsa04150  mTOR signaling pathway
hsa05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    6396 (SEC13)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6396 (SEC13)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    6396 (SEC13)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    6396 (SEC13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6396 (SEC13)
   04131 Membrane trafficking [BR:hsa04131]
    6396 (SEC13)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     6396 (SEC13)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    6396 (SEC13)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    6396 (SEC13)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 6396
NCBI-ProteinID: NP_899195
OMIM: 600152
HGNC: 10697
Ensembl: ENSG00000157020
Vega: OTTHUMG00000128671
Pharos: P55735(Tbio)
UniProt: P55735
Structure
PDB: 
3BG1 3BG0 5A9Q

Position
3p25.3
AA seq 322 aa
MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPV
WQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLIL
ACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIK
RFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRV
FIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCI
SDVNKGQGSVSASVTEGQQNEQ
NT seq 969 nt   +upstreamnt  +downstreamnt
atggtgtcagtaattaacactgtggatacctcccatgaggacatgattcacgacgcccag
atggactactatggcacccgcctggcaacctgctcatcagacaggtccgtcaaaatcttt
gatgtgcgcaatggagggcagatccttatcgccgacctcaggggtcatgagggtcctgtg
tggcaagtggcctgggctcaccccatgtacggcaacatcctggcatcgtgctcctatgac
cggaaagtcattatctggagagaggaaaacggcacctgggagaagagccacgagcatgcg
ggacacgactcctcagtgaactcggtgtgctgggccccccatgactacggcctgatcctg
gcctgtgggagctcggatggggccatctccctgctgacttacaccggggaaggccaatgg
gaagtaaagaagatcaacaacgctcacaccattggctgcaatgccgtcagctgggcccct
gctgttgtacctggaagcctcatagaccacccatcggggcagaaacccaattacatcaag
aggtttgcatcaggtggctgtgacaacctcatcaagctgtggaaggaggaggaggacggc
cagtggaaggaggagcagaagctagaagcgcacagtgactgggttcgagatgtggcctgg
gccccctccatcggcctgcccaccagcaccatcgccagctgctcccaggatggtcgtgtg
ttcatttggacctgtgatgatgcctcaagcaatacgtggtcccctaaattgttgcacaag
ttcaacgatgtggtgtggcatgtgagctggtccatcacagccaacatcctggctgtctct
ggtggagacaataaggtgaccctgtggaaggagtcagttgatgggcagtgggtgtgcatc
agtgatgtcaacaagggccagggctccgtatcagcatcagtgacagagggccagcagaac
gagcagtga

KEGG   Homo sapiens (human): 79726
Entry
79726             CDS       T01001                                 

Gene name
WDR59, CDW12, FP977, p90-120
Definition
(RefSeq) WD repeat domain 59
  KO
K20409  WD repeat-containing protein 59
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    79726 (WDR59)
SSDB
Motif
Pfam: WD40 Zn_ribbon_17 zinc_ribbon_16 RWD ANAPC4_WD40
Other DBs
NCBI-GeneID: 79726
NCBI-ProteinID: NP_085058
OMIM: 617418
HGNC: 25706
Ensembl: ENSG00000103091
Vega: OTTHUMG00000170831
Pharos: Q6PJI9(Tdark)
UniProt: Q6PJI9
Position
16q23.1
AA seq 974 aa
MAARWSSENVVVEFRDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKW
DIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDL
LVTSSVDTYIYIWDIKDTRKPTVALSAVAGASQVKWNKKNANCLATSHDGDVRIWDKRKP
STAVEYLAAHLSKIHGLDWHPDSEHILATSSQDNSVKFWDYRQPRKYLNILPCQVPVWKA
RYTPFSNGLVTVMVPQLRRENSLLLWNVFDLNTPVHTFVGHDDVVLEFQWRKQKEGSKDY
QLVTWSRDQTLRMWRVDSQMQRLCANDILDGVDEFIESISLLPEPEKTLHTEDTDHQHTA
SHGEEEALKEDPPRNLLEERKSDQLGLPQTLQQEFSLINVQIRNVNVEMDAADRSCTVSV
HCSNHRVKMLVKFPAQYPNNAAPSFQFINPTTITSTMKAKLLKILKDTALQKVKRGQSCL
EPCLRQLVSCLESFVNQEDSASSNPFALPNSVTPPLPTFARVTTAYGSYQDANIPFPRTS
GARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGLIAPMKIRTEAPGNLRLY
SGSPTRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRQIKAAGKVIIQDIACLLPVHK
SLGELYILNVNDIQETCQKNAASALLVGRKDLVQVWSLATVATDLCLGPKSDPDLETPWA
RHPFGRQLLESLLAHYCRLRDVQTLAMLCSVFEAQSRPQGLPNPFGPFPNRSSNLVVSHS
RYPSFTSSGSCSSMSDPGLNTGGWNIAGREAEHLSSPWGESSPEELRFGSLTYSDPRERE
RDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVSCPPDPHKGIEFGV
YCSHCRSEVRGTQCAICKGFTFQCAICHVAVRGSSNFCLTCGHGGHTSHMMEWFRTQEVC
PTGCGCHCLLESTF
NT seq 2925 nt   +upstreamnt  +downstreamnt
atggcggcgcgatggagcagcgaaaacgtggttgtagagttccgtgactcccaggcaact
gcgatgtctgtggactgtcttgggcagcatgcagtgctttctggccgcagattcttatac
atcgtcaatctagatgcccctttcgaaggtcaccgaaagatctctcgccagagcaaatgg
gacattggagctgtgcagtggaatcctcatgacagctttgcacactattttgcggcttcg
agtaaccaacgagtagacctttacaagtggaaagacggcagtggggaagttggcacaacc
ttacaaggccacactcgtgtcatcagcgacttggactgggcggtgtttgagcctgacctc
ctggttaccagctctgtggacacctacatctacatttgggatatcaaagacacaaggaaa
cctactgttgcactgtctgctgttgcgggtgcctcccaggtcaaatggaataaaaaaaat
gctaactgccttgccaccagccatgacggcgatgtgcggatatgggataagaggaaaccc
agtacagcagtggaatatctagccgcccacctctccaaaatccatggcctggactggcac
ccagacagcgagcacattcttgctacctccagtcaagacaattctgtgaagttctgggat
taccgccagcctcggaaatacctcaatattcttccttgccaggtgcctgtctggaaggcc
agatacacacctttcagcaatggattggtgactgtgatggttccccagctgcggagggaa
aacagccttctcctgtggaatgtctttgacttgaacaccccagtccacaccttcgtgggg
catgatgatgtggtcctggagttccagtggaggaagcagaaggaagggtccaaggactat
caactggtgacgtggtcccgggatcagaccttgagaatgtggcgggtggattcccagatg
cagaggctttgtgcaaatgacatattagatggtgttgatgagttcattgagagtatttcc
cttctgccggaacctgagaagaccctgcacactgaagatacagatcaccagcacactgca
agccatggggaggaagaagccctaaaagaagatccccctagaaatctcctggaagagagg
aaatcagatcaactggggctgcctcagaccttgcagcaggaattctccctgatcaatgtg
caaatccggaatgtcaatgtggagatggatgcggcagacaggagctgcacagtgtctgtg
cactgcagcaaccatcgtgtcaagatgctggtgaagttccctgcacagtacccaaacaac
gccgccccttccttccagtttattaaccccacaaccatcacatccaccatgaaagctaag
ctgctgaagatcctgaaggacacagccctgcagaaagtgaagcgtggccagagctgcctg
gagccctgcctgcgccagctcgtctcctgccttgagtcctttgtgaaccaggaagacagc
gcttccagcaacccgtttgcactccccaactctgtcactccccccttaccgacgtttgcg
cgggtgaccacggcttacgggtcgtaccaggacgccaacattccctttcctaggacttct
ggggccaggttctgcggagcaggttacctggtatatttcacaaggcccatgacaatgcat
cgggcggtgtctcccacagagcctactccgagatctctctcagccttgtctgcttatcac
actggcttgatcgcgcccatgaagatccgcacagaggcccctgggaaccttcgtttatac
agtgggagccccactcgcagcgagaaagagcaggtctccatcagctccttctactacaag
gagcggaaatcaagacgatggaaaagtaagcgtgagggatcagactctggcaatcgacag
atcaaggctgctgggaaagtcatcatccaggatattgcttgcctcctgcctgttcacaaa
tcgctgggagagctgtacatattgaatgtgaatgatattcaggaaacatgtcagaagaat
gccgcctctgccttgctcgttggaagaaaggatcttgtccaggtttggtcgctggctacg
gtagctacagatctttgccttggtccgaaatctgacccagatttggaaacaccctgggct
cgacatccatttgggcggcagctgctggagtccctgttggctcactattgccggctccgg
gatgttcagacactggcgatgctctgtagcgtgtttgaagcccagtctcggcctcagggg
ctaccaaacccctttgggccttttcctaaccgttcttctaatcttgtggtgtcccatagt
cgatatcctagctttacctcttctggttcctgctccagtatgtcagacccagggctcaac
actggcggctggaacatagcgggaagagaggcagagcacttgtcctccccttggggagaa
tcctcaccagaagagctccgctttgggagtctgacctacagtgatccccgtgagcgagaa
cgcgaccagcatgataaaaataaaaggctcctggaccccgccaatacccagcaatttgat
gactttaagaaatgctatggggaaatcctctaccgttggggtctgagagagaagcgagct
gaagtgttgaagtttgtctcctgtcctcctgaccctcacaaagggatcgagttcggcgtg
tactgcagccactgccggagtgaggtccgtggcacgcagtgtgccatctgcaaaggcttc
acgttccagtgtgccatctgtcacgtggctgtgcggggatcgtccaatttctgcctgacc
tgtgggcacggtggccacaccagccacatgatggagtggtttcggacccaggaggtgtgt
cccaccgggtgtgggtgccactgcctgcttgaaagcactttctga

KEGG   Homo sapiens (human): 81929
Entry
81929             CDS       T01001                                 

Gene name
SEH1L, SEC13L, SEH1A, SEH1B, Seh1
Definition
(RefSeq) SEH1 like nucleoporin
  KO
K14299  nucleoporin SEH1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa04150  mTOR signaling pathway
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    81929 (SEH1L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    81929 (SEH1L)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    81929 (SEH1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    81929 (SEH1L)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     81929 (SEH1L)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 81929
NCBI-ProteinID: NP_112493
OMIM: 609263
HGNC: 30379
Ensembl: ENSG00000085415
Vega: OTTHUMG00000181909
Pharos: Q96EE3(Tbio)
UniProt: Q96EE3
Structure
PDB: 
5A9Q

Position
18p11.21
AA seq 360 aa
MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSV
WRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVK
FAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSP
MIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAI
ATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDG
CVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtttgtggctcgcagcatcgcggcggaccacaaggatctcatccacgatgtctctttc
gacttccacgggcggcggatggcaacctgctccagcgatcagagcgttaaggtctgggat
aaaagtgaaagtggtgattggcattgtactgctagctggaagacacatagtggatctgta
tggcgtgtgacatgggcccatcctgaatttgggcaggttttggcttcctgttcttttgac
cgaacagctgctgtatgggaagaaatagtaggagaatcaaatgataaactgcgaggacag
agccactgggttaaaaggacaactctggtggatagcagaacatctgttactgatgtgaag
tttgctcccaagcacatgggtcttatgttagcaacctgttccgcagatggtatagtaaga
atctatgaggcaccagatgttatgaatctcagccagtggtctttgcagcatgagatctca
tgtaagctaagctgtagttgtatttcttggaacccttcaagctctcgtgctcattccccc
atgatcgccgtaggaagtgatgacagtagccccaacgcaatggccaaggttcagattttt
gaatataatgaaaacaccaggaaatatgcaaaagctgaaactcttatgacagtcactgat
cctgttcatgatattgcattcgctccaaatttgggaagatctttccatattctagcaata
gcgaccaaagatgtgagaatttttacattaaagcctgtgaggaaagaactgacttcctct
ggtgggccaacaaagtttgaaatccatatagtggctcagttcgataatcataattctcag
gtctggcgagtgagttggaatataacaggaacggtgctagcatcttcaggagatgatggg
tgtgtaagattgtggaaagctaattatatggacaattggaagtgtactggtattttgaaa
ggtaatgggagcccagtcaatgggagttctcagcagggaacctcaaatccttccctaggt
tcaactattccaagtcttcagaattcattaaatggatcttctgctggcagaaagcacagc
tga

KEGG   Homo sapiens (human): 84219
Entry
84219             CDS       T01001                                 

Gene name
WDR24, C16orf21, JFP7
Definition
(RefSeq) WD repeat domain 24
  KO
K20408  WD repeat-containing protein 24
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    84219 (WDR24)
SSDB
Motif
Pfam: WD40 Zn_ribbon_17
Other DBs
NCBI-GeneID: 84219
NCBI-ProteinID: NP_115635
HGNC: 20852
Ensembl: ENSG00000127580
Vega: OTTHUMG00000090421
Pharos: Q96S15(Tdark)
UniProt: Q96S15
Position
16p13.3
AA seq 790 aa
MEKMSRVTTALGGSVLTGRTMHCHLDAPANAISVCRDAAQVVVAGRSIFKIYAIEEEQFV
EKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHK
RTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVSTFSGQSESVRDVQFSIRDYFTFA
STFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPEDRGWLATGGRDKMVKVWDMTTH
RAKEMHCVQTIASVARVKWRPECRHHLATCSMMVDHNIYVWDVRRPFVPAAMFEEHRDVT
TGIAWRHPHDPSFLLSGSKDSSLCQHLFRDASQPVERANPEGLCYGLFGDLAFAAKESLV
AAESGRKPYTGDRRHPIFFKRKLDPAEPFAGLASSALSVFETEPGGGGMRWFVDTAERYA
LAGRPLAELCDHNAKVARELGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLP
LMNSFNLKDMAPGLGSETRLDRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLL
GDVEGEEDELYLLDPEHAHPEDPECVLPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGS
EADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVL
GERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCS
HCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCP
AGCGHLCEYS
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggagaagatgtcccgtgtgaccacagccctgggtggcagcgtgctgacaggccgcacc
atgcactgccacctggatgctcccgccaatgccatcagtgtgtgccgcgacgcagcccag
gtggtcgtggcaggccgtagcatcttcaagatctatgccatcgaggaggaacagttcgtg
gaaaagctgaacctgcgtgtggggcgcaagccttcgcttaacctgagctgtgctgacgtg
gtctggcaccagatggatgagaacctgctggccacagcagccaccaatggcgtggtggtc
acgtggaacctgggccggccatcccgcaacaagcaggaccagctgttcacagaacacaag
cgcacggtaaacaaagtctgcttccaccccaccgaagcccacgtgctgctcagtggctcc
caggatggcttcatgaagtgctttgacctccgcagaaaggactctgtcagcaccttctcg
ggccagtcggagagcgtgcgggacgtgcagttcagtatccgggactacttcaccttcgcc
tccacctttgagaacggcaatgtgcagctctgggacatccggcgtcccgaccggtgcgag
aggatgttcacagcccacaacggacccgtcttctgctgcgactggcaccccgaggacagg
ggctggttggccactggagggcgcgacaagatggtgaaggtctgggacatgaccacgcac
cgtgccaaggagatgcactgtgtgcagaccatcgcctcggtggcccgtgtgaagtggcgg
ccagagtgccgccaccacctggccacgtgctccatgatggtggaccacaacatctatgtt
tgggacgtgcgccggcccttcgtgccagctgccatgtttgaggaacaccgagacgtcacc
acgggaattgcctggcgccacccccacgacccctccttcctgctgtctggctccaaggac
agctcgctgtgccagcacctgttccgcgacgccagccagcccgtcgagcgcgccaaccct
gagggcctctgctacggcctcttcggggacctggccttcgccgccaaggagagcctcgtg
gctgccgagtcggggcgcaagccctacactggcgaccggcgccaccccatcttctttaag
cgcaagctggaccctgccgagcccttcgcaggcctcgcctccagtgccctcagtgtcttt
gagacggagccaggtggcggcggcatgcgctggtttgtggacacagctgagcgttatgcg
ctggctggccggccactggccgagctctgtgaccacaacgcaaaggtggctcgagagctt
ggccgcaaccaggtggcgcaaacgtggaccatgctgcggatcatctactgcagccctggc
ctagtgcccactgcaaacctcaaccacagtgtgggcaagggtggctcctgtggcctcccg
ctcatgaacagtttcaacctgaaggatatggccccagggttgggcagtgagacgcggctg
gaccgcagcaaaggagatgcacggagcgacacagttctgctcgactcctcggccacactc
atcaccaatgaggataacgaggaaaccgagggcagcgacgtacctgccgactacctgctg
ggtgacgtggaaggtgaggaggacgagctgtacctgctggatccggaacacgcgcacccc
gaggaccctgagtgcgtgctgccgcaggaggcctttccgctgcgccacgagatcgtggac
acgcctcccgggcccgagcacctgcaggacaaggccgactccccgcacgtgagcggcagc
gaggcggatgtggcctccctggcccccgtggactcctccttctcgctcctgtctgtctca
cacgcgctctacgacagccgcctgccgcccgacttcttcggcgtgctggtgcgcgacatg
ctgcacttctacgctgagcagggcgacgtgcagatggctgtgtctgtgctcatcgtcctg
ggtgaacgggtgcgcaaggacatcgacgagcagacccaggagcactggtacacttcctac
atcgacctgctgcagcgcttccgcctctggaacgtgtccaacgaggtggtcaagctgagc
accagccgcgccgtcagctgcctcaaccaggcctccaccaccctgcacgtcaactgcagc
cactgcaagcggcccatgagcagccggggctgggtctgcgacaggtgccaccgctgcgcc
agcatgtgtgccgtctgccaccacgtagtcaagggtctcttcgtgtggtgccagggctgc
agccacggcggccacctgcagcacatcatgaagtggctggaaggcagctcccactgtccc
gcaggctgcggccacctctgcgagtactcctga

DBGET integrated database retrieval system