KEGG   Homo sapiens (human): 54472Help
Entry
54472             CDS       T01001                                 

Gene name
TOLLIP, IL-1RAcPIP
Definition
(RefSeq) toll interacting protein
  KO
K05402  toll-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    54472 (TOLLIP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    54472 (TOLLIP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   54472 (TOLLIP)
  Exosomal proteins of bladder cancer cells
   54472 (TOLLIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 CUE UBA
Motif
Other DBs
NCBI-GeneID: 54472
NCBI-ProteinID: NP_061882
OMIM: 606277
HGNC: 16476
Ensembl: ENSG00000078902
Vega: OTTHUMG00000133333
Pharos: Q9H0E2(Tbio)
UniProt: Q9H0E2 Q6FIE9
Structure
PDB: 

Position
11p15.5
AA seq 274 aa AA seqDB search
MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVV
QAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMV
MPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKAIQDM
FPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaccgtcagcactcagcgcgggccggtgtacatcggtgagctcccgcaggac
ttcctccgcatcacgcccacacagcagcagcggcaggtccagctggacgcccaggcggcc
cagcagctgcagtacggaggcgcagtgggcaccgtgggccgactgaacatcacggtggta
caggcaaagttggccaagaattacggcatgacccgcatggacccctactgccgactgcgc
ctgggctacgcggtgtacgagacgcccacggcacacaatggcgccaagaatccccgctgg
aataaggtcatccactgcacggtgcccccaggcgtggactctttctatctcgagatcttc
gatgagagagccttctccatggacgaccgcattgcctggacccacatcaccatcccggag
tccctgaggcagggcaaggtggaggacaagtggtacagcctgagcgggaggcagggggac
gacaaggagggcatgatcaacctcgtcatgtcctacgcgctgcttccagctgccatggtg
atgccaccccagcccgtggtcctgatgccaacagtgtaccagcagggcgttggctatgtg
cccatcacagggatgcccgctgtctgtagccccggcatggtgcccgtggccctgcccccg
gccgccgtgaacgcccagccccgctgtagcgaggaggacctgaaagccatccaggacatg
ttccccaacatggaccaggaggtgatccgctccgtgctggaagcccagcgagggaacaag
gatgccgccatcaactccctgctgcagatgggggaggagccatag

DBGET integrated database retrieval system