KEGG   Homo sapiens (human): 54474Help
Entry
54474             CDS       T01001                                 

Gene name
KRT20, CD20, CK-20, CK20, K20, KRT21
Definition
(RefSeq) keratin 20
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    54474 (KRT20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    54474 (KRT20)
   04147 Exosome [BR:hsa04147]
    54474 (KRT20)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     54474 (KRT20)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   54474 (KRT20)
  Exosomal proteins of other body fluids (saliva and urine)
   54474 (KRT20)
  Exosomal proteins of colorectal cancer cells
   54474 (KRT20)
  Exosomal proteins of melanoma cells
   54474 (KRT20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament
Motif
Other DBs
NCBI-GeneID: 54474
NCBI-ProteinID: NP_061883
OMIM: 608218
HGNC: 20412
Ensembl: ENSG00000171431
Vega: OTTHUMG00000133366
Pharos: P35900(Tbio)
UniProt: P35900
Position
17q21.2
AA seq 424 aa AA seqDB search
MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLT
GGGDLFVGNEKMAMQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRDYSAY
YRQIEELRSQIKDAQLQNARCVLQIDNAKLAAEDFRLKYETERGIRLTVEADLQGLNKVF
DDLTLHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHLGNTVNVEVDAAPGLNLGVIMN
EMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIEL
QSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIK
TRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEV
EENI
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggatttcagtcgcagaagcttccacagaagcctgagctcctccttgcaggcccctgta
gtcagtacagtgggcatgcagcgcctcgggacgacacccagcgtttatgggggtgctgga
ggccggggcatccgcatctccaactccagacacacggtgaactatgggagcgatctcaca
ggcggcggggacctgtttgttggcaatgagaaaatggccatgcagaacctaaatgaccgt
ctagcgagctacctagaaaaggtgcggaccctggagcagtccaactccaaacttgaagtg
caaatcaagcagtggtacgaaaccaacgccccgagggctggtcgcgactacagtgcatat
tacagacaaattgaagagctgcgaagtcagattaaggatgctcaactgcaaaatgctcgg
tgtgtcctgcaaattgataatgctaaactggctgctgaggacttcagactgaagtatgag
actgagagaggaatacgtctaacagtggaagctgatctccaaggcctgaataaggtcttt
gatgacctaaccctacataaaacagatttggagattcaaattgaagaactgaataaagac
ctagctctcctcaaaaaggagcatcaggaggaagtcgatggcctacacaagcatctgggc
aacactgtcaatgtggaggttgatgctgctccaggcctgaaccttggcgtcatcatgaat
gaaatgaggcagaagtatgaagtcatggcccagaagaaccttcaagaggccaaagaacag
tttgagagacagactgcagttctgcagcaacaggtcacagtgaatactgaagaattaaaa
ggaactgaggttcaactaacggagctgagacgcacctcccagagccttgagatagaactc
cagtcccatctcagcatgaaagagtctttggagcacactctagaggagaccaaggcccgt
tacagcagccagttagccaacctccagtcgctgttgagctctctggaggcccaactgatg
cagattcggagtaacatggaacgccagaacaacgaataccatatccttcttgacataaag
actcgacttgaacaggaaattgctacttaccgccgccttctggaaggagaagacgtaaaa
actacagaatatcagttaagcaccctggaagagagagatataaagaaaaccaggaagatt
aagacagtcgtgcaagaagtagtggatggcaaggtcgtgtcatctgaagtcaaagaggtg
gaagaaaatatctaa

DBGET integrated database retrieval system