KEGG   Homo sapiens (human): 54476
Entry
54476             CDS       T01001                                 
Symbol
RNF216, CAHH, TRIAD3, U7I1, UBCE7IP1, ZIN
Name
(RefSeq) ring finger protein 216
  KO
K11976  E3 ubiquitin-protein ligase RNF216 [EC:2.3.2.31]
Organism
hsa  Homo sapiens (human)
Disease
H02144  Gordon Holmes syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    54476 (RNF216)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     54476 (RNF216)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    54476 (RNF216)
SSDB
Motif
Pfam: RE_Bsp6I DUF226
Other DBs
NCBI-GeneID: 54476
NCBI-ProteinID: NP_996999
OMIM: 609948
HGNC: 21698
Ensembl: ENSG00000011275
Pharos: Q9NWF9(Tbio)
UniProt: Q9NWF9 A8K8N1
Structure
Position
7:complement(5620047..5781663)
AA seq 866 aa
MEEGNNNEEVIHLNNFHCHRGQEWINLRDGPITISDSSDEERIPMLVTPAPQQHEEEDLD
DDVILTEDDSEDDYGEFLDLGPPGISEFTKPSGQTEREPKPGPSHNQAANDIVNPRSEQK
VIILEEGSLLYTESDPLETQNQSSEDSETELLSNLGESAALADDQAIEEDCWLDHPYFQS
LNQQPREITNQVVPQERQPEAELGRLLFQHEFPGPAFPRPEPQQGGISGPSSPQPAHPLG
EFEDQQLASDDEEPGPAFPMQESQEPNLENIWGQEAAEVDQELVELLVKETEARFPDVAN
GFIEEIIHFKNYYDLNVLCNFLLENPDYPKREDRIIINPSSSLLASQDETKLPKIDFFDY
SKLTPLDQRCFIQAADLLMADFKVLSSQDIKWALHELKGHYAITRKALSDAIKKWQELSP
ETSGKRKKRKQMNQYSYIDFKFEQGDIKIEKRMFFLENKRRHCRSYDRRALLPAVQQEQE
FYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKEC
LIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYAD
ELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAEKDDIKYR
TSIEEKMTAARIRKCHKCGTGLIKSEGCNRMSCRCGAQMCYLCRVSINGYDHFCQHPRSP
GAPCQECSRCSLWTDPTEDDEKLIEEIQKEAEEEQKRKNGENTFKRIGPPLEKPVEKVQR
VEALPRPVPQNLPQPQMPPYAFAHPPFPLPPVRPVFNNFPLNMGPIPAPYVPPLPNVRVN
YDFGPIHMPLEHNLPMHFGPQPRHRF
NT seq 2601 nt   +upstreamnt  +downstreamnt
atggaagagggaaacaacaatgaagaggtaattcacttgaacaactttcactgccatcgg
ggacaagagtggatcaatctccgagatgggcccatcaccatatctgactcctcagatgag
gaaaggattccaatgctggtcaccccagctcctcagcagcatgaagaagaggacctggat
gatgatgtcatcctgacagaagatgattctgaggatgactacggtgaatttctggatctt
gggcctcctggaatctctgaattcactaagccaagtggccaaacagaaagagaacccaag
cctggaccgagtcataaccaagcagcaaatgacattgtcaaccccagatcagagcagaaa
gtcatcatcttggaagaaggtagccttctttacacagaaagcgatcctttggaaactcag
aaccagtcatccgaagactcagagacagagctgttatcaaatctaggagagtcagctgct
ctagcagatgatcaggccatcgaagaagactgctggttagatcatccttacttccagtct
ctgaaccaacagccccgtgaaataacaaaccaggtcgttcctcaggaacggcagcctgaa
gcagaactgggccgcttgttgtttcagcatgaattcccagggcccgcttttccaaggccg
gaaccccagcaaggtgggatttcaggcccctcttctcctcagcctgcccatcctctagga
gagtttgaagaccagcagttagcaagtgatgatgaagagccaggtccagcctttccaatg
caagaatctcaagagcccaatttggaaaacatttgggggcaagaagctgcagaggtagat
caagagctcgttgaactactagtgaaagaaacggaagcaagatttccagatgtagcaaat
gggtttattgaggaaataattcattttaagaattattatgatctgaatgtactttgtaat
tttcttctggaaaacccagattatccaaagagagaagacagaatcattataaatcccagt
agcagtctgctggccagccaagatgagacaaagttgcctaaaatagacttttttgactat
tctaaattgacccctcttgaccagcgctgcttcatccaagctgctgacctcctcatggcc
gacttcaaagtgctcagtagtcaggacatcaagtgggccctgcacgagctcaaaggacac
tatgcaatcacccgaaaggccttgtctgatgccattaaaaaatggcaggagctgtcacca
gaaaccagtggaaaaaggaagaagagaaaacaaatgaaccagtattcttacattgatttc
aagtttgaacaaggtgacataaaaatagaaaagaggatgttctttcttgaaaataagcga
cgacattgtaggtcctatgaccgacgtgctctccttccagctgtgcaacaagagcaggag
ttctatgagcagaaaatcaaagagatggcagagcatgaagactttttgcttgccctacag
atgaatgaagaacagtatcaaaaggatggccagctgattgagtgtcgctgctgctatggg
gaatttccattcgaggagctgacgcagtgcgcagatgctcacttgttctgcaaagagtgt
ctcatcagatatgcccaagaggcagtctttggatctggaaagttggagctcagctgcatg
gaaggcagctgcacgtgttcgttcccaaccagtgagctggagaaggtgctcccccagacc
atcctgtataagtactatgagcgaaaagccgaggaggaggttgcggcagcctacgccgac
gagcttgtcaggtgcccgtcctgtagctttccggctctgttggacagtgatgtgaagagg
ttcagctgtcctaatcctcactgccgaaaggaaacctgtaggaagtgtcagggactctgg
aaagaacataatggcctcacctgtgaagagctggctgaaaaagacgacatcaagtaccgt
acctctattgaagaaaaaatgactgctgcccgcattagaaaatgccacaagtgtgggact
ggcctcatcaaatctgaaggctgcaaccgcatgtcttgccgctgtggtgcccagatgtgc
tacctctgtcgagtttctattaatggatatgaccatttctgccaacatccccgctcacca
ggagccccttgccaggagtgttcaagatgctctctctggaccgatcccactgaagatgat
gagaagcttattgaggaaatccagaaggaggctgaagaggaacagaaaagaaagaatgga
gagaacaccttcaaacgcattggacccccgctggagaagcctgtggagaaggtgcagagg
gtggaggccctcccgaggcccgttccgcagaacctgccacagccacagatgccaccctat
gccttcgcgcacccacccttccccctgcctcccgtgcggcctgtgttcaacaacttccca
ctcaacatggggcctatcccagccccgtacgtgccccctctgcccaacgtgcgggtcaac
tatgacttcggtcccatccacatgcccctggagcacaacctgcccatgcactttggcccc
cagccgcggcatcgcttctga

DBGET integrated database retrieval system