KEGG   Homo sapiens (human): 54487Help
Entry
54487             CDS       T01001                                 

Gene name
DGCR8, C22orf12, DGCRK6, Gy1, pasha
Definition
(RefSeq) DGCR8 microprocessor complex subunit
  KO
K18419  microprocessor complex subunit DGCR8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54487 (DGCR8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     54487 (DGCR8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dsrm WW PEGA
Motif
Other DBs
NCBI-GeneID: 54487
NCBI-ProteinID: NP_073557
OMIM: 609030
HGNC: 2847
Ensembl: ENSG00000128191
Vega: OTTHUMG00000150503
Pharos: Q8WYQ5(Tbio)
UniProt: Q8WYQ5
Structure
PDB: 

Position
22q11.21
AA seq 773 aa AA seqDB search
METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSE
LPAEDPFNFYGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKI
SVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESAD
KKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYE
DDFDNDVDALLEEGLCAPKKRRTEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPT
EPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD
NEEREQSSDLTPSGDVSPVKPLSRSAELEFPLDEPDSMGADPGPPDEKDPLGAEAAPGAL
GQVKAKVEVCKDESVDLEEFRSYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESER
PILPANQKLITLSVQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSE
PFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKPKDSEELEYFNH
ISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKH
TVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQ
YAKKNKPNLHILSKLQEEMKRLAEEREETRKKPKMSIVASAQPGGEPLCTVDV
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggagacagatgagagcccctctccgctcccgtgtgggcccgcaggagaagcggtgatg
gagagccgagctcgccccttccaagcgctgccccgtgagcagtctccaccacctcccctg
caaacgtccagtggtgcagaggtaatggacgttggctctggtggtgatggacagtccgaa
ctccctgctgaggaccccttcaacttctacggagcttctcttctctccaaaggatccttc
tctaagggccgcctcctcatagacccgaactgtagtggccacagcccgcgcaccgcccgg
cacgcacctgcggtccggaagttctcccctgaccttaagttgcttaaggatgtaaagatt
agcgtgagctttaccgagagctgcaggagtaaggacaggaaggtgctgtacacaggagca
gagcgcgacgtgcgggcggagtgcggtctgctccttagccctgtcagtggggacgtgcat
gcttgtccctttggcgggagtgttggtgacggggtaggcatagggggtgagagtgctgat
aagaaggatgaggagaatgagctggatcaggaaaagagagtggagtatgcagtgctcgat
gagttagaagattttactgacaatttggagctagatgaagaaggagcaggcgggttcacg
gctaaagcaatcgttcagagagacagagtggatgaagaggccttgaatttcccctacgag
gatgactttgacaacgatgtggatgctctgctggaagaaggcctttgtgcccccaaaaag
aggcgaacagaggaaaaatatggcggagacagcgaccatccgtccgatggagagacaagt
gtgcagccgatgatgaccaagattaaaacagtgctcaaaagtcgtggccgcccacctaca
gagccgctgcccgacgggtggatcatgacattccataactctggagtcccggtgtaccta
cacagagagtctcgggtggtcacctggtccaggccatacttcttgggaacgggaagcata
cggaaacacgaccctcctctgagtagcatcccttgtctgcattataagaaaatgaaggac
aacgaggaacgggagcaaagcagtgacctcacccctagtggggatgtgtcccccgtcaag
cccctgagccgatctgcagagctggagtttcccctggatgagcctgactctatgggtgct
gacccggggcccccggacgagaaagacccactaggggctgaggcagcccctggggccctg
gggcaggtgaaggccaaagtcgaggtgtgcaaagatgaatccgttgatctcgaggaattt
cgaagctacctggagaagcgttttgactttgagcaagttactgtgaaaaaattcaggact
tgggctgagcggcggcaattcaatcgggaaatgaagcggaagcaggcggagtccgagagg
cccatcttgccagccaatcagaagctcattactttatcagtgcaagatgcacccacaaag
aaagagtttgttattaaccccaacgggaaatccgaggtctgcatcctgcacgagtacatg
cagcgtgtcctcaaggtccgccctgtctataatttctttgaatgtgagaacccaagtgag
ccttttggtgcctcggtgaccattgatggtgtgacttacggatctggaactgcaagcagc
aaaaaacttgcgaagaataaagctgcccgagctacactggaaatcctcatccctgacttt
gttaaacagacctctgaagagaagcccaaagacagtgaagaactcgagtattttaaccac
atcagcatcgaggactcgcgggtctacgagctgaccagcaaggctgggctgttgtctcca
tatcagatcctccacgagtgccttaaaagaaaccatgggatgggtgacacgtctatcaag
tttgaagtggttcctgggaaaaaccagaagagtgaatacgtcatggcgtgtggcaagcac
acagtgcgcgggtggtgtaagaacaagagagttggaaagcagttagcctcacagaagatc
cttcagctgctgcacccacatgtcaagaactgggggtctttactgcgcatgtatggccgt
gagagcagcaagatggtcaagcaggagacatcggacaagagtgtgattgagctgcagcag
tatgccaagaagaacaagcccaacctgcacatcctcagcaagctccaagaggagatgaag
aggctagctgaggaaagggaggagactcgaaagaagcccaagatgtccattgtggcgtcc
gcccagcctggcggtgagcccctgtgcaccgtggacgtgtga

DBGET integrated database retrieval system