KEGG   Homo sapiens (human): 54492
Entry
54492             CDS       T01001                                 

Gene name
NEURL1B, NEURL3, RNF67B, hNeur2, neur2
Definition
(RefSeq) neuralized E3 ubiquitin protein ligase 1B
  KO
K01931  protein neuralized [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    54492 (NEURL1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     54492 (NEURL1B)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    54492 (NEURL1B)
SSDB
Motif
Pfam: Neuralized zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2
Other DBs
NCBI-GeneID: 54492
NCBI-ProteinID: NP_001136123
OMIM: 615893
HGNC: 35422
Ensembl: ENSG00000214357
Vega: OTTHUMG00000163281
Pharos: A8MQ27(Tdark)
UniProt: A8MQ27
Position
5q35.1
AA seq 555 aa
MGNTVHRTLPDPSPPARLLATRPCCGPGPERRPVLGEAPRFHAQAKGKNVRLDGHSRRAT
RRNSFCNGVTFTQRPIRLYEQVRLRLVAVRPGWSGALRFGFTAHDPSLMSAQDIPKYACP
DLVTRPGYWAKALPENLALRDTVLAYWADRHGRVFYSVNDGEPVLFHCGVAVGGPLWALI
DVYGITDEVQLLESAFADTLTPARLSQARFSACLPPSSHDAANFDNNELENNQVVAKLGH
LALGRAPGPPPADAAAAAIPCGPRERPRPASSPALLEADLRFHATRGPDVSLSADRKVAC
APRPDGGRTLVFSERPLRPGESLFVEVGRPGLAAPGALAFGITSCDPGVLRPNELPADPD
ALLDRKEYWVVARAGPVPSGGDALSFTLRPGGDVLLGINGRPRGRLLCVDTTQALWAFFA
VRGGVAGQLRLLGTLQSSPATTTPSGSLSGSQDDSDSDMTFSVNQSSSASESSLVTAPSS
PLSPPVSPVFSPPEPAGIKNGECTVCFDGEVDTVIYTCGHMCLCHSCGLRLKRQARACCP
ICRRPIKDVIKIYRP
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgggcaacacggtgcaccggaccctgccagacccgagcccaccggcgcgcctcctggcc
acccggccgtgctgcggccccggccccgagcgacgcccggtcctgggcgaggcgccgcgc
ttccacgcgcaggccaaaggcaagaacgtgcggctggacggccactcgcgccgggccaca
cggcgcaacagcttctgcaatggcgtcacgttcacgcagcggcccatccggctgtacgag
caggtgcggctgcgcctggtggccgtgcgccctggctggagcggcgcgctgcgcttcggc
ttcaccgcgcacgatccgtcgctcatgagcgcccaggacatccccaagtacgcctgcccg
gacctggtcacgcggccgggctactgggccaaggcactgcccgagaacctggcgctgcgc
gacacggtgctggcctactgggccgaccgccacggccgcgtgttctacagcgtgaacgac
ggcgagccggtgctcttccactgcggcgtggccgtgggcggcccgctctgggcgctcatt
gatgtctacggcatcaccgacgaggtgcagcttctggagagcgccttcgctgacacgctg
acgcccgcgcgcctcagccaggcccgcttcagcgcctgcctgccgcccagcagccacgac
gcggccaacttcgacaacaacgagctcgagaacaaccaggtggtggccaagctgggccac
ctggcgctgggccgcgccccgggcccaccgccagccgacgccgcggccgccgccattccg
tgcgggccccgtgagcgcccgcggcccgcgtcgtcgccggcgctactggaggccgacctg
cgcttccacgcaacacgcgggcccgacgtgagcctgtcggccgaccgcaaagtggcctgc
gcaccgcggcccgacggcggccgcacgctggtcttctccgagcgcccgctgcggcccggc
gagagcctcttcgtggaggtgggccgtccggggctggcggcgcccggcgcgctggccttc
ggcatcacgtcgtgcgacccgggcgtgctacggcccaacgagctgcccgccgacccagac
gcgctgctcgaccgcaaagagtactgggtggtggcgcgcgccgggcccgtgccgagcggc
ggcgacgcgctcagcttcacgctgcggcccggcggcgacgtgctcctgggcatcaacggg
cgtccgcgcggccgcctgctgtgcgtcgacaccacgcaggcgctctgggccttcttcgcc
gtgcgcggcggcgtcgcgggccagctgcgtctcctcggtaccctgcagtccagccctgcg
accacgactccatcagggtccctcagcggctcccaggacgatagtgattcagatatgacc
ttcagtgtcaaccagtcctcctcggcatctgagtcatccctggtgacggcccccagctcc
ccgctgagccccccggtgtcccccgtgttctccccaccggagccggcaggcatcaagaat
ggcgagtgcacggtgtgcttcgatggcgaggtggacacggtcatctacacgtgtggacac
atgtgcctgtgccacagctgcggcctgcggctcaagcgacaggcccgggcctgctgcccc
atctgccggcggcccatcaaggacgtcattaagatctacaggccatag

DBGET integrated database retrieval system