KEGG   Homo sapiens (human): 5450
Entry
5450              CDS       T01001                                 

Gene name
POU2AF1, BOB1, OBF-1, OBF1, OCAB
Definition
(RefSeq) POU class 2 homeobox associating factor 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PD-C2-AF1
Other DBs
NCBI-GeneID: 5450
NCBI-ProteinID: NP_006226
OMIM: 601206
HGNC: 9211
Ensembl: ENSG00000110777
Vega: OTTHUMG00000166659
Pharos: Q16633(Tbio)
UniProt: Q16633
Structure
PDB: 
1CQT

Position
11q23.1
AA seq 256 aa
MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATY
TTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSA
DMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWP
QPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEE
DSDAYALNHTLSVEGF
NT seq 771 nt   +upstreamnt  +downstreamnt
atgctctggcaaaaacccacagctccggagcaagccccagccccggcccggccataccag
ggcgtccgtgtgaaggagccagtgaaggaactgctgaggaggaagcgaggccacgccagc
agtggggcagcacctgcacctacggcggtggtgctgccccatcagcccctggcgacctac
accacagtgggtccttcctgcctggacatggaaggttctgtgtctgcagtgacagaggag
gctgccctgtgtgccggctggctctcccagcccaccccggccaccctgcagcccctggcc
ccatggacaccttacaccgagtatgtgccccatgaagctgtcagctgcccctactcagct
gacatgtatgtgcagcccgtgtgccccagctacacggtggtggggccctcctcagtgttg
acctatgcctctccgccactcatcaccaatgtcacgacaagaagctccgccacgcccgca
gtggggcccccgctggagggcccagagcaccaggcacccctcacctatttcccgtggcct
cagcccctttccacactacccacctccaccctgcagtaccagcctccggccccagcccta
cctgggccccagtttgtccagctccccatctctatcccagagccagtccttcaggacatg
gaagaccccagaagagccgccagctcgttgaccatcgacaagctgcttttggaggaagag
gatagcgacgcctatgcgcttaaccacactctctctgtggaaggcttttag

DBGET integrated database retrieval system