KEGG   Homo sapiens (human): 54502
Entry
54502             CDS       T01001                                 
Symbol
RBM47, NET18
Name
(RefSeq) RNA binding motif protein 47
  KO
K25083  RNA-binding protein 47
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    54502 (RBM47)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  RRM domain-containing proteins
   54502 (RBM47)
SSDB
Motif
Pfam: RRM_1 RRM_7 RRM_5 ERp29
Other DBs
NCBI-GeneID: 54502
NCBI-ProteinID: NP_001092104
OMIM: 619104
HGNC: 30358
Ensembl: ENSG00000163694
Pharos: A0AV96(Tdark)
UniProt: A0AV96
Structure
Position
4:complement(40423280..40630852)
AA seq 593 aa
MTAEDSTAAMSSDSAAGSSAKVPEGVAGAPNEAALLALMERTGYSMVQENGQRKYGGPPP
GWEGPHPQRGCEVFVGKIPRDVYEDELVPVFEAVGRIYELRLMMDFDGKNRGYAFVMYCH
KHEAKRAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEIAKVTEGVLD
VIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDED
VMETVKILYVRNLMIETTEDTIKKSFGQFNPGCVERVKKIRDYAFVHFTSREDAVHAMNN
LNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGAAEAAQQPSYVYSCDPYTLAYYGYP
YNALIGPNRDYFVKAGSIRGRGRGAAGNRAPGPRGSYLGGYSAGRGIYSRYHEGKGKQQE
KGYELVPNLEIPTVNPVAIKPGTVAIPAIGAQYSMFPAAPAPKMIEDGKIHTVEHMISPI
AVQPDPASAAAAAAAAAAAAAAVIPTVSTPPPFQGRPITPVYTVAPNVQRIPTAGIYGAS
YVPFAAPATATIATLQKNAAAAAAMYGGYAGYIPQAFPAAAIQVPIPDVYQTY
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgaccgcagaggattccaccgcagccatgagcagtgactcggccgccgggtcctccgcc
aaggtgcccgagggcgtggcgggcgcgcccaacgaggcagcactgctggcgctgatggag
cgcacgggctacagcatggtgcaagagaacgggcagcgcaagtacggcggcccaccgccc
ggctgggagggcccgcacccgcagcgtggctgcgaggtcttcgtgggcaagatcccgcgc
gacgtgtacgaggacgagctggtgcccgtgttcgaggccgtgggccgcatctacgagctg
cgcctcatgatggactttgacggcaagaaccgcggctacgccttcgtcatgtactgccac
aagcacgaggccaagcgcgcagtgcgtgagctcaacaactacgagatccgcccgggccgc
ctgctcggcgtgtgctgcagcgtggacaactgccgcctcttcatcggcgggatccccaag
atgaagaagcgcgaggaaatcctggaggagattgccaaggtcaccgagggcgtgctggac
gtgatcgtctacgccagcgcggccgacaagatgaagaaccgcggcttcgccttcgtggag
tacgagagccaccgcgcggctgccatggctcgccgcaagctcatgcctggccgcatccag
ctgtggggccaccagatcgccgtggactgggccgaacctgagatcgacgtggacgaggac
gtgatggagaccgtgaagatcctctacgtgcgcaacctcatgatcgagaccaccgaggac
accatcaagaagagcttcggccagttcaaccccggctgcgtggagcgcgtcaagaagatc
cgcgactacgccttcgtgcacttcaccagccgcgaggatgccgtgcatgccatgaacaac
ctcaacggcactgagctggagggctcgtgcctggaggtcacgctggccaagcccgtggac
aaggagcagtactcgcgctaccagaaggcagccaggggcggcggcgcggctgaggcagcg
cagcagcccagctacgtgtactcctgcgacccctacacactggcctactacggctacccc
tacaacgcgctcattgggcccaacagggactactttgtgaaagcaggcagcataagaggc
cgagggcgaggtgcagctggcaacagagccccagggcctaggggttcctacctcggggga
tattctgctggtcgtggtatatatagccgatatcatgaagggaaaggaaagcagcaagaa
aaaggatatgaactggtgccgaatttggaaatccctaccgtcaacccagttgccattaaa
cctggtacagtagccatccctgccattggggctcagtattccatgtttccagcagctcca
gcccctaaaatgattgaagatggcaaaatccacacagtggagcacatgatcagccccatt
gctgtgcagccagacccagccagtgctgctgccgccgcagccgcggccgcagccgccgca
gccgctgtcattcccactgtgtcgacgccaccacctttccagggccgcccaataactcca
gtatacacggtggctccaaacgttcagagaattcctactgccgggatctacggggccagt
tacgtgccatttgctgctccagctacagccacgatcgccacactacagaagaacgcggca
gccgcggccgccatgtatggaggatacgcaggctacatacctcaggccttccctgctgct
gccattcaggtccccatccccgacgtctaccagacatactga

DBGET integrated database retrieval system