KEGG   Homo sapiens (human): 54507
Entry
54507             CDS       T01001                                 

Gene name
ADAMTSL4, ADAMTSL-4, ECTOL2, TSRC1
Definition
(RefSeq) ADAMTS like 4
  KO
K23369  ADAMTS-like protein 4
Organism
hsa  Homo sapiens (human)
Disease
H00662  Ectopia lentis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    54507 (ADAMTSL4)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Thrombospondin domain-containing proteins
  ADAMTS-like proteins
   54507 (ADAMTSL4)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_spacer1 PLAC TSP1_spondin ADAM_CR_3 TSP1_CCN
Other DBs
NCBI-GeneID: 54507
NCBI-ProteinID: NP_061905
OMIM: 610113
HGNC: 19706
Ensembl: ENSG00000143382
Vega: OTTHUMG00000034863
Pharos: Q6UY14(Tbio)
UniProt: Q6UY14 Q9UFG7 B7ZMJ3
Position
1q21.2
AA seq 1074 aa
MENWTGRPWLYLLLLLSLPQLCLDQEVLSGHSLQTPTEEGQGPEGVWGPWVQWASCSQPC
GVGVQRRSRTCQLPTVQLHPSLPLPPRPPRHPEALLPRGQGPRPQTSPETLPLYRTQSRG
RGGPLRGPASHLGREETQEIRAARRSRLRDPIKPGMFGYGRVPFALPLHRNRRHPRSPPR
SELSLISSRGEEAIPSPTPRAEPFSANGSPQTELPPTELSVHTPSPQAEPLSPETAQTEV
APRTRPAPLRHHPRAQASGTEPPSPTHSLGEGGFFRASPQPRRPSSQGWASPQVAGRRPD
PFPSVPRGRGQQGQGPWGTGGTPHGPRLEPDPQHPGAWLPLLSNGPHASSLWSLFAPSSP
IPRCSGESEQLRACSQAPCPPEQPDPRALQCAAFNSQEFMGQLYQWEPFTEVQGSQRCEL
NCRPRGFRFYVRHTEKVQDGTLCQPGAPDICVAGRCLSPGCDGILGSGRRPDGCGVCGGD
DSTCRLVSGNLTDRGGPLGYQKILWIPAGALRLQIAQLRPSSNYLALRGPGGRSIINGNW
AVDPPGSYRAGGTVFRYNRPPREEGKGESLSAEGPTTQPVDVYMIFQEENPGVFYQYVIS
SPPPILENPTPEPPVPQLQPEILRVEPPLAPAPRPARTPGTLQRQVRIPQMPAPPHPRTP
LGSPAAYWKRVGHSACSASCGKGVWRPIFLCISRESGEELDERSCAAGARPPASPEPCHG
TPCPPYWEAGEWTSCSRSCGPGTQHRQLQCRQEFGGGGSSVPPERCGHLPRPNITQSCQL
RLCGHWEVGSPWSQCSVRCGRGQRSRQVRCVGNNGDEVSEQECASGPPQPPSREACDMGP
CTTAWFHSDWSSKCSAECGTGIQRRSVVCLGSGAALGPGQGEAGAGTGQSCPTGSRPPDM
RACSLGPCERTWRWYTGPWGECSSECGSGTQRRDIICVSKLGTEFNVTSPSNCSHLPRPP
ALQPCQGQACQDRWFSTPWSPCSRSCQGGTQTREVQCLSTNQTLSTRCPPQLRPSRKRPC
NSQPCSQRPDDQCKDSSPHCPLVVQARLCVYPYYTATCCRSCAHVLERSPQDPS
NT seq 3225 nt   +upstreamnt  +downstreamnt
atggagaactggactggcaggccctggctgtatctgctgctgcttctgtccctccctcag
ctctgcttggatcaggaggtgttgtccggacactctcttcagacacctacagaggagggc
cagggccccgaaggtgtctggggaccttgggtccagtgggcctcttgctcccagccctgc
ggggtgggggtgcagcgcaggagccggacatgtcagctccctacagtgcagctccacccg
agtctgcccctccctccccggcccccaagacatccagaagccctcctcccccggggccag
ggtcccagaccccagacttctccagaaaccctccccttgtacaggacacagtctcgggga
aggggtggcccacttcgaggtcccgcttcccacctagggagagaggagacccaggagatt
cgagcggccaggaggtcccggcttcgagaccccatcaagccaggaatgttcggttatggg
agagtgccctttgcattgccactgcaccggaaccgcaggcaccctcggagcccacccaga
tctgagctgtccctgatctcttctagaggggaagaggctattccgtcccctactccaaga
gcagagccattctccgcaaacggcagcccccaaactgagctccctcccacagaactgtct
gtccacaccccatccccccaagcagaacctctaagccctgaaactgctcagacagaggtg
gcccccagaaccaggcctgcccccctacggcatcaccccagagcccaggcctctggcaca
gagcccccctcacccacgcactccttaggagaaggtggcttcttccgtgcatcccctcag
ccacgaaggccaagttcccagggttgggccagtccccaggtagcagggagacgccctgat
ccttttccttcggtccctcggggccgaggccagcagggccaagggccttggggaacgggg
gggactcctcacgggccccgcctggagcctgaccctcagcacccgggcgcctggctgccc
ctgctgagcaacggcccccatgccagctccctctggagcctctttgctcccagtagccct
attccaagatgttctggggagagtgaacagctaagagcctgcagccaagcgccctgcccc
cctgagcagccagacccccgggccctgcagtgcgcagcctttaactcccaggaattcatg
ggccagctgtatcagtgggagcccttcactgaagtccagggctcccagcgctgtgaactg
aactgccggccccgtggcttccgcttctatgtccgtcacactgaaaaggtccaggatggg
accctgtgtcagcctggagcccctgacatctgtgtggctggacgctgtctgagccccggc
tgtgatgggatccttggctctggcaggcgtcctgatggctgtggagtctgtgggggtgat
gattctacctgtcgccttgtttcggggaacctcactgaccgagggggccccctgggctat
cagaagatcttgtggattccagcgggagccttgcggctccagattgcccagctccggcct
agctccaactacctggcacttcgtggccctgggggccggtccatcatcaatgggaactgg
gctgtggatccccctgggtcctacagggccggcgggaccgtctttcgatataaccgtcct
cccagggaggagggcaaaggggagagtctgtcggctgaaggccccaccacccagcctgtg
gatgtctatatgatctttcaggaggaaaacccaggcgttttttatcagtatgtcatctct
tcacctcctccaatccttgagaaccccaccccagagccccctgtcccccagcttcagccg
gagattctgagggtggagcccccacttgctccggcaccccgcccagcccggaccccaggc
accctccagcgtcaggtgcggatcccccagatgcccgccccgccccatcccaggacaccc
ctggggtctccagctgcgtactggaaacgagtgggacactctgcatgctcagcgtcctgc
gggaaaggtgtctggcgccccattttcctctgcatctcccgtgagtcgggagaggaactg
gatgaacgcagctgtgccgcgggtgccaggcccccagcctcccctgaaccctgccacggc
accccatgccccccatactgggaggctggcgagtggacatcctgcagccgctcctgtggc
cccggcacccagcaccgccagctgcagtgccggcaggaatttggggggggtggctcctcg
gtgcccccggagcgctgtggacatctcccccggcccaacatcacccagtcttgccagctg
cgcctctgtggccattgggaagttggctctccttggagccagtgctccgtgcggtgcggc
cggggccagagaagccggcaggttcgctgtgttgggaacaatggtgatgaagtgagcgag
caggagtgtgcgtcaggccccccgcagccccccagcagagaggcctgtgacatggggccc
tgtactactgcctggttccacagcgactggagctccaagtgctcagccgagtgtgggacg
ggaatccagcggcgctctgtggtctgccttgggagtggggcagccctcgggccaggccag
ggggaagcaggagcaggaactgggcagagctgtccaacaggaagccggccccctgacatg
cgcgcctgcagcctggggccctgtgagagaacttggcgctggtacacagggccctggggt
gagtgctcctccgaatgtggctctggcacacagcgtagagacatcatctgtgtatccaaa
ctggggacggagttcaacgtgacttctccgagcaactgttctcacctccccaggccccct
gccctgcagccctgtcaagggcaggcctgccaggaccgatggttttccacgccctggagc
ccatgttctcgctcctgccaagggggaacgcagacacgggaggtccagtgcctgagcacc
aaccagaccctcagcacccgatgccctcctcaactgcggccctccaggaagcgcccctgt
aacagccaaccctgcagccagcgccctgatgatcaatgcaaggacagctctccacattgc
cccctggtggtacaggcccggctctgcgtctacccctactacacagccacctgttgccgc
tcttgcgcacatgtcctggagcggtctccccaggatccctcctga

DBGET integrated database retrieval system