KEGG   Homo sapiens (human): 54518Help
Entry
54518             CDS       T01001                                 

Gene name
APBB1IP, INAG1, PREL1, RARP1, RIAM
Definition
(RefSeq) amyloid beta precursor protein binding family B member 1 interacting protein
  KO
K17704  amyloid beta A4 precursor protein-binding family B member 1-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    54518 (APBB1IP)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    54518 (APBB1IP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RA PH THRAP3_BCLAF1 PH_11
Motif
Other DBs
NCBI-GeneID: 54518
NCBI-ProteinID: NP_061916
OMIM: 609036
HGNC: 17379
Ensembl: ENSG00000077420
Vega: OTTHUMG00000017841
Pharos: Q7Z5R6(Tbio)
UniProt: Q7Z5R6
Structure
PDB: 

Position
10p12.1
AA seq 666 aa AA seqDB search
MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG
ISQYEDDLPPPPADPVLDLPLPPPPPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVV
KVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERFFEDHENV
VEVLSDWTRDTENKILFLEKEEKYAVFKNPQNFYLDNRGKKESKETNEKMNAKNKESLLE
ESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFE
NVNIYYGTQHKMKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDTRTLNQWVMGIRIAKYG
KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVL
QEAQRHAETSKDKKPALGNHHDPAVPRAPHAPKSSLPPPPPVRRSSDTSGSPATPLKAKG
TGGGGLPAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPP
PPPPPPAPAPAPVPDSARPPPAVAKRPPVPPKRQENPGHPGGAGGGEQDFMSDLMKALQK
KRGNVS
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagtcaagtgaagacatagaccaaatgttcagcactttgctgggagagatggat
cttctgactcagagtttaggagttgacactctccctcctcctgaccctaatccacccaga
gctgaatttaactacagtgtggggtttaaagatttaaatgagtccttaaatgcactggaa
gaccaagatttagatgctctcatggcagatctggtagcagacataagtgaggctgagcag
aggacaatccaggcacagaaagagtccttgcagaatcaacatcattcagcatctctacaa
gcatcaattttcagtggtgcagcctctcttggttatggaacaaatgttgctgccactggt
atcagccaatatgaggatgacttaccacctccaccagccgatcctgtgttagaccttcca
ctgccaccaccacctcctgaacctctctctcaggaagaggaagaagcccaagccaaggct
gataaaattaagctggcgctggaaaaactgaaggaggccaaggttaagaagctcgtcgtc
aaggtgcacatgaatgataacagcacaaagtcactgatggtggatgagcggcagctggcc
cgagatgttctggacaaccttttcgagaaaactcattgtgactgcaatgtagactggtgt
ctttatgaaatctacccggaactacaaattgagaggttttttgaagaccatgaaaatgtt
gttgaagtcttatcagactggacaagagacacagaaaataaaatactatttttggagaaa
gaggagaaatatgctgtatttaaaaacccccagaatttctacttggataacagaggaaaa
aaagaaagcaaggaaactaatgagaaaatgaatgctaagaacaaggaatccttacttgag
gaaagtttctgtggaacatctatcattgtaccagaactggaaggagctctttatttgaaa
gaagatggaaagaaatcctggaaaaggcgctattttcttttacgggcttctggaatttat
tatgtacccaaaggaaagactaagacatctcgagatctggcgtgttttatacagtttgaa
aatgtcaacatttactatgggactcagcataaaatgaaatataaagcgcccactgactat
tgctttgttttaaagcacccccaaattcagaaggagtcccagtatatcaagtatctctgc
tgtgatgacacaagaacccttaaccagtgggtcatgggaatacggatagccaagtatggg
aagactctctatgataactaccagcgggctgtggcaaaggctggacttgcctctcggtgg
acaaacttggggacagtcaatgcagctgcaccagctcagccatctacaggacctaaaaca
ggcaccacccagcccaatggacagattccccaggctacacattctgtcagtgctgttctc
caagaggcccagagacatgctgaaacatcgaaggataagaagccagccctcgggaaccac
cacgacccggcagtgccccgggccccgcacgcccccaagtccagcctgcccccgccccct
ccggtgcggaggtcctccgacaccagcggcagtcccgccacgcccctcaaggccaagggc
acaggcggcgggggcttgcccgccccacccgacgacttcctgccgccgccgccaccgccg
ccgcccctcgatgaccctgagctcccgccgccgcccccggacttcatggagccgccccca
gacttcgtgcccccgcccccgccgtcgtacgcagggatcgcgggctcagagctgcccccg
ccgccgccgccgccgcccgcgcccgcgcccgcccccgtccccgactccgccaggccgccc
cccgcggtggccaagaggcctcctgtgccccccaagaggcaagagaacccagggcacccc
ggcggagcaggaggcggggagcaagatttcatgtcagacctcatgaaagctttgcaaaag
aagagaggcaacgtgtcctag

DBGET integrated database retrieval system