KEGG   Homo sapiens (human): 5452
Entry
5452              CDS       T01001                                 

Gene name
POU2F2, OCT2, OTF2, Oct-2
Definition
(RefSeq) POU class 2 homeobox 2
  KO
K09364  POU domain transcription factor, class 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    5452 (POU2F2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    5452 (POU2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5452 (POU2F2)
   03021 Transcription machinery [BR:hsa03021]
    5452 (POU2F2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain POU
    5452 (POU2F2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    Octamer transcription factors
     5452 (POU2F2)
SSDB
Motif
Pfam: Pou Homeodomain
Other DBs
NCBI-GeneID: 5452
NCBI-ProteinID: NP_001193954
OMIM: 164176
HGNC: 9213
Ensembl: ENSG00000028277
Vega: OTTHUMG00000165991
Pharos: P09086(Tbio)
UniProt: P09086
Structure
PDB: 
1HDP

Position
19q13.2
AA seq 479 aa
MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPS
TKIKAEDPSGDSAPAAPLPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHL
QPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLS
HPQPPKCLEPPSHPEEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTT
ISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVDSSLPSPNQLSSPSLGFDGLPGRRRKK
RTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCSA
APMLPSPGKPASYSPHMVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGG
GGGGAAPPLNSIPSVTPPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggttcactccagcatgggggctccagaaataagaatgtctaagcccctggaggccgag
aagcaaggtctggactccccatcagagcacacagacaccgaaagaaatggaccagacact
aatcatcagaacccccaaaataagacctccccattctccgtgtccccaactggccccagt
acaaagatcaaggctgaagaccccagtggcgattcagccccagcagcacccctgccccct
cagccggcccagcctcatctgccccaggcccaactcatgttgacgggcagccagctagct
ggggacatacagcagctcctccagctccagcagctggtgcttgtgccaggccaccacctc
cagccacctgctcagttcctgctaccgcaggcccagcagagccagccaggcctgctaccg
acaccaaatctattccagctacctcagcaaacccagggagctcttctgacctcccagccc
cgggccgggcttcccacacaggccgtgacccgccctacgctgcccgacccgcacctctcg
cacccgcagccccccaaatgcttggagccaccatcccaccccgaggagcccagtgatctg
gaggagctggagcaattcgcccgcaccttcaagcaacgccgcatcaagctgggcttcacg
cagggtgatgtgggcctggccatgggcaagctctacggcaacgacttcagccagacgacc
atttcccgcttcgaggccctcaacctgagcttcaagaacatgtgcaaactcaagcccctc
ctggagaagtggctcaacgatgcagagactatgtctgtggactcaagcctgcccagcccc
aaccagctgagcagccccagcctgggtttcgacggcctgcccggccggagacgcaagaag
aggaccagcatcgagacaaacgtccgcttcgccttagagaagagttttctagcgaaccag
aagcctacctcagaggagatcctgctgatcgccgagcagctgcacatggagaaggaagtg
atccgcgtctggttctgcaaccggcgccagaaggagaaacgcatcaacccctgcagtgcg
gcccccatgctgcccagcccagggaagccggccagctacagcccccatatggtcacaccc
caagggggcgcggggaccttaccgttgtcccaagcttccagcagtctgagcacaacagtt
actaccttatcctcagctgtggggacgctccaccccagccggacagctggagggggtggg
ggcgggggcggggctgcgccccccctcaattccatcccctctgtcactcccccacccccg
gccaccaccaacagcacaaaccccagccctcaaggcagccactcggctatcggcttgtca
ggcctgaaccccagcacgggccctggcctctggtggaaccctgccccttaccagccttga

DBGET integrated database retrieval system