KEGG   Homo sapiens (human): 54536Help
Entry
54536             CDS       T01001                                 

Gene name
EXOC6, EXOC6A, SEC15, SEC15L, SEC15L1, SEC15L3, Sec15p
Definition
(RefSeq) exocyst complex component 6
  KO
K19985  exocyst complex component 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    54536 (EXOC6)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    54536 (EXOC6)
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    54536 (EXOC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec15 AKAP7_NLS COG5 Vps51
Motif
Other DBs
NCBI-GeneID: 54536
NCBI-ProteinID: NP_061926
OMIM: 609672
HGNC: 23196
Ensembl: ENSG00000138190
Vega: OTTHUMG00000018767
Pharos: Q8TAG9(Tbio)
UniProt: Q8TAG9 B2RDH5
Position
10q23.33
AA seq 804 aa AA seqDB search
MAENSESLGTVPEHERILQEIESTDTACVGPTLRSVYDDQPNAHKKFMEKLDACIRNHDK
EIEKMCNFHHQGFVDAITELLKVRTDAEKLKVQVTDTNRRFQDAGKEVIVHTEDIIRCRI
QQRNITTVVEKLQLCLPVLEMYSKLKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQL
MIENLPKLREDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQHQKTFSVSLQKQNKMKF
GKNMYINRDRIPEERNETVLKHSLEEEDENEEEILTVQDLVDFSPVYRCLHIYSVLGDEE
TFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRAY
TDELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLTVIFADTLQGYGFPVNRLFDLLFEI
RDQYNETLLKKWAGVFRDIFEEDNYSPIPVVNEEEYKIVISKFPFQDPDLEKQSFPKKFP
MSQSVPHIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRKP
HIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHTTRLYGLSTFKDARHAAEGE
IYTKLNQKIDEFVQLADYDWTMSEPDGRASGYLMDLINFLRSIFQVFTHLPGKVAQTACM
SACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFID
LRQLLDLFMVWDWSTYLADYGQPASKYLRVNPNTALTLLEKMKDTSKKNNIFAQFRKNDR
DKQKLIETVVKQLRSLVNGMSQHM
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaacagcgagagtctgggcaccgtccccgagcacgagcggatcttgcaggag
atcgagagcaccgacaccgcctgtgtggggcccaccctccggtctgtgtatgatgaccaa
ccaaatgcgcacaagaagtttatggaaaagttagatgcttgtatccgtaatcatgacaag
gaaattgaaaagatgtgtaattttcatcatcagggttttgtagatgctattacagaactc
cttaaagtaaggactgatgcagaaaaactgaaggtgcaagttactgataccaaccgaagg
tttcaagatgctggaaaagaggtgatagtccacacagaagatatcattcgatgtagaatt
cagcagagaaatattacaactgtagtagaaaaattgcagttatgccttcctgtgctagaa
atgtacagtaagctgaaagaacagatgagtgccaaaaggtactattctgccctaaaaact
atggaacaattagagaatgtgtactttccctgggttagtcaataccggttttgtcagctc
atgatagaaaatcttcccaaactccgtgaggatattaaagaaatctccatgtctgatctc
aaagactttttggaaagtattcgaaaacattctgacaaaataggtgaaacagcaatgaaa
caggcacagcatcagaaaaccttcagtgtttctctgcagaaacaaaataaaatgaaattt
gggaaaaatatgtatataaatcgtgatagaattccagaggaaaggaatgaaactgtattg
aaacattcacttgaagaagaggatgagaatgaagaagagatcttaactgttcaggatctt
gttgatttttcccctgtttatcgatgtttgcacatttattctgttttgggtgacgaggaa
acatttgaaaactattatcgaaaacaaagaaagaaacaagcaagactggtattgcaaccc
cagtcgaatatgcatgaaacagttgatggctatagaagatatttcactcaaattgtaggg
ttctttgtggtagaagatcacattttacatgtgacccaaggattagtaaccagggcatac
actgatgaactttggaacatggccctctcaaagataattgctgtccttagagctcattca
tcctattgcactgatcctgatcttgttctggagctgaagaatcttactgtaatatttgca
gatactttacagggttatggttttccagtgaaccgactttttgaccttttatttgaaata
agagaccaatacaatgaaacactgcttaagaaatgggctggagttttcagggacattttt
gaagaagataattacagccccatccctgttgtcaatgaagaagaatataaaattgtcatc
agcaaatttccctttcaagatccagaccttgaaaagcagtctttcccaaagaaattcccc
atgtctcagtcagtgcctcatatttacattcaagttaaagaatttatttatgccagcctt
aaattttcagagtcactacaccggagctcaacagaaatagacgatatgcttagaaaatca
acaaatctgctgctgaccagaactttgagtagctgtttactgaaccttattagaaaacct
catataggtttgacagagctggtacaaatcatcataaacacaacacacctggagcaagct
tgtaaatatcttgaggactttataactaacattacaaatatttcccaagaaactgttcat
actacaagactttatggactttctactttcaaggatgctcgacatgcagcagaaggagaa
atatataccaaactgaatcaaaaaattgatgaatttgttcagcttgctgattatgactgg
acaatgtctgagccagatggaagagctagtggttatttaatggaccttataaattttttg
agaagcatctttcaagtgtttactcatttgcctgggaaagttgctcagacagcttgcatg
tcagcctgccagcatctgtcaacatccttaatgcagatgctactggacagtgagttaaaa
caaataagcatgggagctgttcagcagtttaacttagatgtcatacagtgtgaattgttt
gccagctctgagcctgtgccaggattccagggggataccctgcagctagcattcattgac
ctcagacaactccttgacctgtttatggtttgggattggtctacttacctagctgattat
gggcagccagcttctaagtaccttcgggtgaatccaaacacagcccttactcttttggag
aagatgaaggatactagcaaaaagaacaatatatttgctcagttcaggaagaatgatcga
gacaaacagaagttgatagagacagtcgtgaaacagctgagaagtttggtgaatggtatg
tcccagcacatgtag

DBGET integrated database retrieval system