KEGG   Homo sapiens (human): 5454Help
Entry
5454              CDS       T01001                                 

Gene name
POU3F2, BRN2, N-Oct3, OCT7, OTF-7, OTF7, POUF3, brn-2, oct-7
Definition
(RefSeq) POU class 3 homeobox 2
  KO
K09365  POU domain transcription factor, class 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5454 (POU3F2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   POU domain factors
    5454 (POU3F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pou Homeodomain DUF2722 HTH_31 Homeobox_KN Spt20 Presenilin Pex14_N
Motif
Other DBs
NCBI-GeneID: 5454
NCBI-ProteinID: NP_005595
OMIM: 600494
HGNC: 9215
Ensembl: ENSG00000184486
Vega: OTTHUMG00000015258
Pharos: P20265(Tbio)
UniProt: P20265
Position
6q16.1
AA seq 443 aa AA seqDB search
MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQ
WITALSHGGGGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHG
PGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPS
MGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPP
PPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG
NVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTS
IEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP
GAEDVYGGSRDTPPHHGVQTPVQ
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcagcgtctaaccactacagcctgctcacctccagcgcctccatcgtgcac
gccgagccgcccggcggcatgcagcagggcgcggggggctaccgcgaagcgcagagcctg
gtgcagggcgactacggcgctctgcagagcaacggacacccgctcagccacgctcaccag
tggatcaccgcgctgtcccacggcggcggcggcgggggcggtggcggcggcggggggggc
gggggcggcggcgggggcggcggcgacggctccccgtggtccaccagccccctgggccag
ccggacatcaagccctcggtggtggtgcagcagggcggccgcggagacgagctgcacggg
ccaggcgccctgcagcagcagcatcagcagcagcaacagcaacagcagcagcaacagcag
caacagcagcagcagcagcagcaacagcggccgccgcatctggtgcaccacgccgctaac
caccacccgggacccggggcatggcggagcgcggcggctgcagcgcacctcccaccctcc
atgggagcgtccaacggcggcttgctctactcgcagcccagcttcacggtgaacggcatg
ctgggcgccggcgggcagccggccggtctgcaccaccacggcctgcgggacgcgcacgac
gagccacaccatgccgaccaccacccgcacccgcactcgcacccacaccagcagccgccg
cccccgccgcccccgcagggtccgcctggccacccaggcgcgcaccacgacccgcactcg
gacgaggacacgccgacctcggacgacctggagcagttcgccaagcagttcaagcagcgg
cggatcaaactgggatttacccaagcggacgtggggctggctctgggcaccctgtatggc
aacgtgttctcgcagaccaccatctgcaggtttgaggccctgcagctgagcttcaagaac
atgtgcaagctgaagcctttgttgaacaagtggttggaggaggcggactcgtcctcgggc
agccccacgagcatagacaagatcgcagcgcaagggcgcaagcggaaaaagcggacctcc
atcgaggtgagcgtcaagggggctctggagagccatttcctcaaatgccccaagccctcg
gcccaggagatcacctccctcgcggacagcttacagctggagaaggaggtggtgagagtt
tggttttgtaacaggagacagaaagagaaaaggatgacccctcccggagggactctgccg
ggcgccgaggatgtgtacggggggagtagggacactccaccacaccacggggtgcagacg
cccgtccagtga

DBGET integrated database retrieval system