KEGG   Homo sapiens (human): 54541Help
Entry
54541             CDS       T01001                                 

Gene name
DDIT4, Dig2, REDD-1, REDD1
Definition
(RefSeq) DNA damage inducible transcript 4
  KO
K08270  DNA-damage-inducible transcript 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    54541 (DDIT4)
   04150 mTOR signaling pathway
    54541 (DDIT4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    54541 (DDIT4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    54541 (DDIT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RTP801_C
Motif
Other DBs
NCBI-GeneID: 54541
NCBI-ProteinID: NP_061931
OMIM: 607729
HGNC: 24944
Ensembl: ENSG00000168209
Vega: OTTHUMG00000183961
Pharos: Q9NX09(Tbio)
UniProt: Q9NX09 A0A024QZQ6
Structure
PDB: 

Position
10q22.1
AA seq 232 aa AA seqDB search
MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSS
NSGFGPEEDTAYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMP
SQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLR
LDSRLWPKIQGLFSSANSPFLPGFSQSLTLSTGFRVIKKKLYSSEQLLIEEC
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcctttgggaccgcttctcgtcgtcgtccacctcctcttcgccctcgtccttg
ccccgaactcccaccccagatcggccgccgcgctcagcctgggggtcggcgacccgggag
gaggggtttgaccgctccacgagcctggagagctcggactgcgagtccctggacagcagc
aacagtggcttcgggccggaggaagacacggcttacctggatggggtgtcgttgcccgac
ttcgagctgctcagtgaccctgaggatgaacacttgtgtgccaacctgatgcagctgctg
caggagagcctggcccaggcgcggctgggctctcgacgccctgcgcgcctgctgatgcct
agccagttggtaagccaggtgggcaaagaactactgcgcctggcctacagcgagccgtgc
ggcctgcggggggcgctgctggacgtctgcgtggagcagggcaagagctgccacagcgtg
ggccagctggcactcgaccccagcctggtgcccaccttccagctgaccctcgtgctgcgc
ctggactcacgactctggcccaagatccaggggctgtttagctccgccaactctcccttc
ctccctggcttcagccagtccctgacgctgagcactggcttccgagtcatcaagaagaag
ctgtacagctcggaacagctgctcattgaggagtgttga

DBGET integrated database retrieval system