KEGG   Homo sapiens (human): 5455Help
Entry
5455              CDS       T01001                                 

Gene name
POU3F3, BRN1, OTF8, brain-1, oct-8
Definition
(RefSeq) POU class 3 homeobox 3
  KO
K09365  POU domain transcription factor, class 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5455 (POU3F3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   POU domain factors
    5455 (POU3F3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pou Homeodomain Homeobox_KN HTH_31
Motif
Other DBs
NCBI-GeneID: 5455
NCBI-ProteinID: NP_006227
OMIM: 602480
HGNC: 9216
Ensembl: ENSG00000198914
Vega: OTTHUMG00000153067
Pharos: P20264(Tbio)
UniProt: P20264
Position
2q12.1
AA seq 500 aa AA seqDB search
MATAASNPYLPGNSLLAAGSIVHSDAAGAGGGGGGGGGGGGGGAGGGGGGMQPGSAAVTS
GAYRGDPSSVKMVQSDFMQGAMAASNGGHMLSHAHQWVTALPHAAAAAAAAAAAAVEASS
PWSGSAVGMAGSPQQPPQPPPPPPQGPDVKGGAGRDDLHAGTALHHRGPPHLGPPPPPPH
QGHPGGWGAAAAAAAAAAAAAAAAHLPSMAGGQQPPPQSLLYSQPGGFTVNGMLSAPPGP
GGGGGGAGGGAQSLVHPGLVRGDTPELAEHHHHHHHHAHPHPPHPHHAQGPPHHGGGGGG
AGPGLNSHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTI
CRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGA
LESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQ
VGTVSADTPPPHHGLQTSVQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccacggcggcttctaacccctacctgccggggaacagcctgctcgcggccggctct
attgtgcactcggacgcggcaggggctggcggcggcgggggtggcggcggcggcggcggc
gggggcggcgcagggggcgggggcggcggcatgcagccgggcagcgccgccgtgacctcg
ggcgcctaccggggggacccgtcctctgtcaagatggtccagagcgacttcatgcagggg
gccatggccgccagcaacggcggccatatgctgagccacgcgcaccagtgggtcacagcc
ctgccccacgccgccgccgccgccgccgctgccgccgccgccgccgtggaggcgagctcg
ccgtggtcgggcagcgccgtgggcatggctggcagcccccagcagccaccgcagccgccg
ccgccaccgccgcagggccccgacgtgaagggcggcgccgggcgcgacgacctgcacgcg
ggcacagcgctgcaccaccgcgggccgccgcacctcggacccccgccgccgcccccacac
cagggccaccctgggggctggggggcggccgccgctgccgcagccgcagccgccgccgcc
gccgccgccgcgcacctcccgtccatggccgggggccagcagccgccgccgcagagtctg
ctctactcgcagcccggaggcttcacggtgaacggcatgctgagcgcgccaccggggccc
ggcggcggcggcggcggcgcgggcggtggagcccagagcttggtgcacccggggctggtg
cgcggggacacgccagagctggccgagcaccaccaccaccaccaccaccacgcgcatcct
cacccgccgcacccgcaccacgcgcagggacccccgcaccacggcggcggcggcggcggc
gcggggcctggactcaacagccacgacccgcactcggacgaggacacgccgacgtcggac
gacctggagcagttcgccaagcagttcaagcagcggcgcatcaagctgggcttcacgcag
gccgacgtggggttggcgctgggcacactctacggcaacgtgttctcgcagaccaccatc
tgccgcttcgaggccctgcagctgagcttcaagaacatgtgcaagctcaagccgctgctg
aacaagtggctggaggaggcggactcaagcaccggcagccccacaagcatcgacaagatc
gcggcgcagggccgcaagcgcaagaagcggacctctatcgaggtgagcgtcaagggcgcg
ctggagagccacttcctcaagtgccccaagccctccgcgcaggagatcaccaacctggcc
gacagcctgcagctcgagaaggaggtggtgcgggtctggttctgcaatcggcgccaaaag
gagaagcgcatgacgccgcccgggatccaacagcagacgcccgacgacgtctactcgcag
gtgggcaccgtgagcgccgacacgccgccgcctcaccacgggctgcagacgagcgttcag
tga

DBGET integrated database retrieval system