KEGG   Homo sapiens (human): 54550Help
Entry
54550             CDS       T01001                                 

Gene name
NECAB2, EFCBP2, stip-2
Definition
(RefSeq) N-terminal EF-hand calcium binding protein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ABM EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7 EF-hand_5 FPP SPARC_Ca_bdg EF-hand_10 Hormone_3
Motif
Other DBs
NCBI-GeneID: 54550
NCBI-ProteinID: NP_061938
OMIM: 618130
HGNC: 23746
Ensembl: ENSG00000103154
Vega: OTTHUMG00000137636
Pharos: Q7Z6G3(Tdark)
UniProt: Q7Z6G3
Position
16q23.3
AA seq 386 aa AA seqDB search
MCERAARLCRAGAHRLLREPPQQGRALGGLLRWVGARMGEPRESLAPAAPADPGPASPRG
GTAVILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELC
DYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSL
LSSVESAVEAIEEQTSQLRQNHIKPSHSAAQTWCGSPTPASAPNHKLMAMEQGKTLPSAT
EDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDGTNMHLQLVRQEMAVCPEQLS
EFLDSLRQYLRGTTGVRNCFHITAVRLSDGFTFVIYEFWETEEAWKRHLQSPLCKAFRHV
KVDTLSQPEALSRILVPAAWCTVGRD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgagcgggcggcgcgcctgtgcagggccggcgcgcacaggctgctccgggagccg
ccgcagcagggccgggcgctgggcgggctgctgcgctgggtgggcgccaggatgggcgag
ccccgggagtcgctggcccccgccgcccccgcggaccccggcccagcctcgccgcgcggg
ggcaccgccgtcatcctggacattttccgccgtgcggacaaaaatgatgatgggaagctg
tccttggaggaattccagctcttctttgcagatggcgtccttaatgagaaagaactggag
gatctctttcacacgattgactctgacaacaccaaccatgtggacaccaaggagctgtgt
gattactttgtggaccacatgggtgactatgaggatgtcctggcctccctggagaccttg
aatcactctgtcctgaaggccatgggttataccaagaaggtatatgagggtgggagcaac
gtggaccagtttgtgacccgcttcctcctgaaggagacggccaatcagatccagtcgctg
ctgagctcagtggagagtgcggtggaggccatcgaggaacagaccagccagctccgacag
aaccacatcaaacccagccacagcgcggcacagacctggtgtggaagccccactcccgcc
tctgcccccaaccacaagctcatggctatggaacaaggcaagacccttccatctgccacg
gaggatgcaaaggaagagggtctggaagcccagatcagccgcttggcagagctgattggg
aggctggagagcaaagcactgtggttcgacctgcagcagcgcctgtcagatgaagatggc
accaacatgcacctgcagctggtccggcaggagatggccgtgtgccccgagcaactgagc
gagtttctggactctctgcgccagtatctgcgggggaccactggcgtgaggaactgcttc
cacatcactgccgtgaggctctcagatggcttcacctttgtcatctatgagttctgggag
acagaggaggcgtggaagaggcacctgcagagccccctgtgtaaggcgttccggcacgtc
aaggtggacacactgagccagcctgaggccctctccaggatcttggtgccagctgcttgg
tgcacggtgggacgggactga

DBGET integrated database retrieval system