KEGG   Homo sapiens (human): 54579Help
Entry
54579             CDS       T01001                                 

Gene name
UGT1A5, UDPGT, UDPGT_1-5, UGT1E
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A5
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54579 (UGT1A5)
   00053 Ascorbate and aldarate metabolism
    54579 (UGT1A5)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    54579 (UGT1A5)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54579 (UGT1A5)
   00860 Porphyrin and chlorophyll metabolism
    54579 (UGT1A5)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54579 (UGT1A5)
   00982 Drug metabolism - cytochrome P450
    54579 (UGT1A5)
   00983 Drug metabolism - other enzymes
    54579 (UGT1A5)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    54579 (UGT1A5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54579 (UGT1A5)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54579 (UGT1A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 54579
NCBI-ProteinID: NP_061951
OMIM: 606430
HGNC: 12537
Ensembl: ENSG00000240224
Vega: OTTHUMG00000059120
Pharos: P35504(Tdark)
UniProt: P35504 Q5DSZ9
Position
2q37.1
AA seq 534 aa AA seqDB search
MATGLQVPLPQLATGLLLLLSVQPWAESGKVLVVPTDGSHWLSMREALRDLHARGHQVVV
LTLEVNMYIKEENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM
SLIIHRSCVELLHNEALIRHLHATSFDVVLTDPFHLCAAVLAKYLSIPAVFFLRNIPCDL
DFKGTQCPNPSSYIPRLLTTNSDHMTFLQRVKNMLYPLALSYLCHAVSAPYASLASELFQ
REVSVVDLVSHASVWLFRGDFVMDYPRPIMPNMVFIGGINCANGKPLSQEFEAYINASGE
HGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQND
LLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAH
DLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccacaggactccaggttcccctgccgcagctggccacaggactgctgcttctcctc
agtgtccagccctgggctgagagtgggaaggtgctggtggtgcccactgatggcagccac
tggctcagcatgcgggaggccttgcgggacctccatgcgagaggccaccaggtggtggtc
ctcaccctggaggtgaatatgtacatcaaagaagagaactttttcaccctgacaacgtat
gccatttcatggacccaggacgaatttgatcgccttttgctgggtcacactcaatcgttc
tttgaaacagaacatcttctgatgaaattttctagaagaatggcaattatgaacaatatg
tctttgatcatacataggtcttgtgtggagctactgcataatgaggccctgatcaggcac
ctgcatgctacttcctttgatgtggttctaacagacccctttcacctctgcgcggcggtg
ctggctaagtacctgtcgattcctgctgtgtttttcttgaggaacattccatgtgattta
gactttaagggcacacagtgtccaaacccttcctcctatattcctagattactaacgacc
aattcagaccacatgacattcctgcaaagggtcaagaacatgctctaccctctggccctg
tcctacctttgccatgctgtttctgctccttatgcaagccttgcctctgagctttttcag
agagaggtgtcagtggtggatcttgtcagccatgcatctgtgtggctgttccgaggggac
tttgtgatggattaccccaggccgatcatgcccaacatggtcttcattgggggcatcaac
tgtgccaacgggaagccactatctcaggaatttgaagcctacattaatgcttctggagaa
catggaattgtggttttctctttgggatcaatggtctcagaaattccagagaagaaagct
atggcaattgctgatgctttgggcaaaatccctcagacagtcctgtggcggtacactgga
acccgaccatcgaatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgat
ctgcttggtcacccgatgacccgtgcctttatcacccatgctggttcccatggtgtttat
gaaagcatatgcaatggcgttcccatggtgatgatgcccttgtttggtgatcagatggac
aatgcaaagcgcatggagactaagggagctggagtgaccctgaatgttctggaaatgact
tctgaagatttagaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaac
atcatgcgcctctccagccttcacaaggaccgcccggtggagccgctggacctggccgtg
ttctgggtggagtttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccac
gacctcacctggtaccagtaccattccttggacgtgattggtttcctcttggccgtcgtg
ctgacagtggccttcatcacctttaaatgttgtgcttatggctaccggaaatgcttgggg
aaaaaagggcgagttaagaaagcccacaaatccaagacccattga

DBGET integrated database retrieval system