KEGG   Homo sapiens (human): 5458Help
Entry
5458              CDS       T01001                                 

Gene name
POU4F2, BRN3.2, BRN3B, Brn-3b
Definition
(RefSeq) POU class 4 homeobox 2
  KO
K09366  POU domain transcription factor, class 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5458 (POU4F2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   POU domain factors
    5458 (POU4F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pou Homeodomain HTH_31 Homeobox_KN DUF4770
Motif
Other DBs
NCBI-GeneID: 5458
NCBI-ProteinID: NP_004566
OMIM: 113725
HGNC: 9219
Ensembl: ENSG00000151615
Vega: OTTHUMG00000162045
Pharos: Q12837(Tbio)
UniProt: Q12837
Position
4q31.22
AA seq 409 aa AA seqDB search
MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSSSNAGGGGGGG
GGGGGGGGRSSSSSSSGSSGGGGSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIV
SQSKSHHHHPPHHSPFKPDATYHTMNTIPCTSAASSSSVPISHPSALAGTHHHHHHHHHH
HHQPHQALEGELLEHLSPGLALGAMAGPDGAVVSTPAHAPHMATMNPMHQAALSMAHAHG
LPSHMGCMSDVDADPRDLEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTIC
RFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGAEKKRKRTSIAAPEKRSL
EAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgatgtccctgaacagcaagcaggcgtttagcatgccgcacggcggcagcctg
cacgtggagcccaagtactcggcactgcacagcacctcgccgggctcctcggctcccatc
gcgccctcggccagctcccccagcagctcgagcaacgctggtggtggcggcggcggcggc
ggcggcggcggcggcggcggaggccgaagcagcagctccagcagcagtggcagcagcggc
ggcgggggctcggaggctatgcggagagcctgtcttccaaccccaccgagcaatatattc
ggcgggctggatgagagtctgctggcccgcgccgaggctctggcagccgtggacatcgtc
tcccagagcaagagccaccaccaccatccaccccaccacagccccttcaaaccggacgcc
acctaccacactatgaataccatcccgtgcacgtcggccgcctcttcttcatcggtgccc
atctcgcacccttccgcgttggcgggcacgcaccaccaccaccaccatcaccaccaccac
caccaccaaccgcaccaggcgctggagggcgagctgctggagcacctgagtcccgggctg
gccctgggcgctatggcgggccccgacggcgctgtggtgtccacgccggctcacgcgccg
cacatggccaccatgaaccccatgcaccaagcagcgctcagcatggcccacgcgcacggg
ctgccgtcgcacatgggctgcatgagcgacgtggacgccgacccgcgggacctggaggca
ttcgccgagcgcttcaagcagcgacgcatcaagctgggggtgacccaggcagatgtgggc
tccgcgctggccaacctcaagatccccggcgtgggctcgcttagccagagcaccatctgc
aggttcgagtccctcacactgtcccacaataatatgatcgcgctcaaacccatcctgcag
gcatggctcgaggaggccgagaagtcccaccgcgagaagctcaccaagcctgaactcttc
aatggcgcggagaagaagcgcaagcgcacgtccatcgctgcgccagagaagcgctcgctc
gaagcctactttgccattcagcctcggccctcctctgaaaagatcgccgccatcgcggag
aagctggacctgaagaaaaacgtggtgcgcgtctggttctgcaaccagaggcagaaacag
aaaagaatgaaatattccgccggcatttag

DBGET integrated database retrieval system