KEGG   Homo sapiens (human): 54600Help
Entry
54600             CDS       T01001                                 

Gene name
UGT1A9, HLUGP4, LUGP4, UDPGT, UDPGT_1-9, UGT-1I, UGT1-09, UGT1-9, UGT1.9, UGT1A9S, UGT1AI, UGT1I
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A9
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54600 (UGT1A9)
   00053 Ascorbate and aldarate metabolism
    54600 (UGT1A9)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    54600 (UGT1A9)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54600 (UGT1A9)
   00860 Porphyrin and chlorophyll metabolism
    54600 (UGT1A9)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54600 (UGT1A9)
   00982 Drug metabolism - cytochrome P450
    54600 (UGT1A9)
   00983 Drug metabolism - other enzymes
    54600 (UGT1A9)
 09160 Human Diseases
  09161 Cancers: Overview
   05204 Chemical carcinogenesis
    54600 (UGT1A9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54600 (UGT1A9)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54600 (UGT1A9)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54600 (UGT1A9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 54600
NCBI-ProteinID: NP_066307
OMIM: 606434
HGNC: 12541
Ensembl: ENSG00000241119
Vega: OTTHUMG00000059124
Pharos: O60656(Tbio)
UniProt: O60656 Q5DSZ5
Position
2q37.1
AA seq 530 aa AA seqDB search
MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMP
EVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLF
FSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEG
AQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLLCHRFFKNALEIASEILQTPVT
EYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcacagggtggaccagcccccttcctctatgtgtgtgtctgctgctgacctgt
ggctttgccgaggcagggaagctactggtagtgcccatggatgggagccactggttcacc
atgaggtcggtggtggagaaactcattctcagggggcatgaggtggttgtagtcatgcca
gaggtgagttggcaactgggaagatcactgaattgcacagtgaagacttattcaacttca
tataccctggaggatctggaccgggagttcaaggcttttgcccatgctcaatggaaagca
caagtacgaagtatatattctctattaatgggttcatacaatgacatttttgacttattt
ttttcaaattgcaggagtttgtttaaagacaaaaaattagtagaatacttaaaggagagt
tcttttgatgcagtgtttctcgatccttttgataactgtggcttaattgttgccaaatat
ttctccctcccctccgtggtcttcgccaggggaatactttgccactatcttgaagaaggt
gcacagtgccctgctcctctttcctatgtccccagaattctcttagggttctcagatgcc
atgactttcaaggagagagtacggaaccacatcatgcacttggaggaacatttattatgc
caccgttttttcaaaaatgccctagaaatagcctctgaaattctccaaacacctgttacg
gagtatgatctctacagccacacatcaatttggttgttgcgaacggactttgttttggac
tatcccaaacccgtgatgcccaacatgatcttcattggtggtatcaactgccatcaggga
aagccgttgcctatggaatttgaagcctacattaatgcttctggagaacatggaattgtg
gttttctctttgggatcaatggtctcagaaattccagagaagaaagctatggcaattgct
gatgctttgggcaaaatccctcagacagtcctgtggcggtacactggaacccgaccatcg
aatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgatctgcttggtcac
ccgatgacccgtgcctttatcacccatgctggttcccatggtgtttatgaaagcatatgc
aatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaatgcaaagcgc
atggagactaagggagctggagtgaccctgaatgttctggaaatgacttctgaagattta
gaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgcccggtggagccgctggacctggccgtgttctgggtggag
tttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccacgacctcacctgg
taccagtaccattccttggacgtgattggtttcctcttggccgtcgtgctgacagtggcc
ttcatcacctttaaatgttgtgcttatggctaccggaaatgcttggggaaaaaagggcga
gttaagaaagcccacaaatccaagacccattga

DBGET integrated database retrieval system