KEGG   Homo sapiens (human): 54619
Entry
54619             CDS       T01001                                 
Symbol
CCNJ, bA690P14.1
Name
(RefSeq) cyclin J
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 54619
NCBI-ProteinID: NP_061957
HGNC: 23434
Ensembl: ENSG00000107443
Pharos: Q5T5M9(Tdark)
UniProt: Q5T5M9
Position
10:96043068..96060870
AA seq 372 aa
MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSA
RHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL
VLTKQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYM
AKYADYFLEVSLQVAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLIAHDN
DVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHPTSEQPSC
QQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQIN
EHYPCITPCFER
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggagctggaggggcagtggtggcgaggacagctggccgccgatattcaccaagcgctt
cgctacaaggagctgaagttgccctcctataaaggccagtcccctcagttaagtctcaga
cggtattttgctgacttgattgccattgtgagcaatcgcttcacactctgcccttctgcc
cgccatcttgctgtctatttactggacctgtttatggaccgctatgacatctctatccag
cagctgcatttagttgcgctttcctgcctgcttctagcaagtaaatttgaagaaaaagaa
gacagtgtgcctaagctggagcagctcaacagcctgggttgtatgactaatatgaatcta
gtattaacaaaacaaaatttgctacatatggaactattattattagaaacctttcagtgg
aacctctgccttccaacagccgcccatttcattgagtattatctctctgaagcagtacac
gaaacagatcttcatgacggctggccaatgatttgcttggaaaagactaaactctacatg
gccaaatatgcagattacttcctggaagtatctttgcaagtagctgctgcatgtgtggct
tcttcgaggattatacttcgtctttctccaacgtggcctacaagactacatcgtcttact
gcctactcttgggatttcttagtgcagtgtattgaacgactgttgatcgctcatgataat
gatgtgaaagaagcaaacaaacagagagggcaagcaggacctcagtcagcgcaactaagt
gtattccagacagcctcccagccatcacggccagttcactttcagcaacctcagtatctc
catcagacacatcagacctcactgcagtatcgccatcctacgtcagaacaaccaagctgt
cagcagattgtatcgaccacacacacctcatcttacacactacagacatgtcctgctggc
ttccaaactagtgttcagggccttgggcacatgcagactggtgttgggatgtcactggca
ataccagtagaagttaagccctgtctgagtgtttcttacaaccggagttatcagataaat
gaacattacccttgtattactccatgttttgaaaggtga

DBGET integrated database retrieval system