KEGG   Homo sapiens (human): 54625Help
Entry
54625             CDS       T01001                                 

Gene name
PARP14, ARTD8, BAL2, PARP-14, pART8
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 14
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    54625 (PARP14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     54625 (PARP14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro PARP WWE Syntaxin_2
Motif
Other DBs
NCBI-GeneID: 54625
NCBI-ProteinID: NP_060024
OMIM: 610028
HGNC: 29232
Ensembl: ENSG00000173193
Vega: OTTHUMG00000159552
Pharos: Q460N5(Tbio)
UniProt: Q460N5 Q8N546
Structure
PDB: 

Position
3q21.1
AA seq 1801 aa AA seqDB search
MAVPGSFPLLVEGSWGPDPPKNLNTKLQMYFQSPKRSGGGECEVRQDPRSPSRFLVFFYP
EDVRQKVLERKNHELVWQGKGTFKLTVQLPATPDEIDHVFEEELLTKESKTKEDVKEPDV
SEELDTKLPLDGGLDKMEDIPEECENISSLVAFENLKANVTDIMLILLVENISGLSNDDF
QVEIIRDFDVAVVTFQKHIDTIRFVDDCTKHHSIKQLQLSPRLLEVTNTIRVENLPPGAD
DYSLKLFFENPYNGGGRVANVEYFPEESSALIEFFDRKVLDTIMATKLDFNKMPLSVFPY
YASLGTALYGKEKPLIKLPAPFEESLDLPLWKFLQKKNHLIEEINDEMRRCHCELTWSQL
SGKVTIRPAATLVNEGRPRIKTWQADTSTTLSSIRSKYKVNPIKVDPTMWDTIKNDVKDD
RILIEFDTLKEMVILAGKSEDVQSIEVQVRELIESTTQKIKREEQSLKEKMIISPGRYFL
LCHSSLLDHLLTECPEIEICYDRVTQHLCLKGPSADVYKAKCEIQEKVYTMAQKNIQVSP
EIFQFLQQVNWKEFSKCLFIAQKILALYELEGTTVLLTSCSSEALLEAEKQMLSALNYKR
IEVENKEVLHGKKWKGLTHNLLKKQNSSPNTVIINELTSETTAEVIITGCVKEVNETYKL
LFNFVEQNMKIERLVEVKPSLVIDYLKTEKKLFWPKIKKVNVQVSFNPENKQKGILLTGS
KTEVLKAVDIVKQVWDSVCVKSVHTDKPGAKQFFQDKARFYQSEIKRLFGCYIELQENEV
MKEGGSPAGQKCFSRTVLAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKA
AGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRA
VQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETIVSAIKENFQFKKDGHCLKEIYLV
DVSEKTVEAFAEAVKTVFKATLPDTAAPPGLPPAAAGPGKTSWEKGSLVSPGGLQMLLVK
EGVQNAKTDVVVNSVPLDLVLSRGPLSKSLLEKAGPELQEELDTVGQGVAVSMGTVLKTS
SWNLDCRYVLHVVAPEWRNGSTSSLKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFP
KNIFAELIISEVFKFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRANGNLVSDKIP
KAKDTQGFYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSK
AILECAGQNVERECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEK
KNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFY
ANMKKREGTQLSSQQSVMSKLASFLGFSKQSPQKKNHLVLEKKTESATFRVCGENVTCVE
YAISWLQDLIEKEQCPYTSEDECIKDFDEKEYQELNELQKKLNINISLDHKRPLIKVLGI
SRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDAR
REKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVV
ELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQL
FHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYY
VRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFR
K
NT seq 5406 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcccggctccttcccgctgctggtcgagggctcctggggccccgaccccccg
aagaacttgaacaccaagttgcagatgtacttccagagcccgaagaggtcgggaggcggc
gagtgtgaggtccgccaggatcccaggagcccatcccgcttcctggtgttcttctacccg
gaggacgttcggcagaaggttctggagagaaaaaatcatgagttggtatggcaaggaaaa
ggaacattcaagttaactgtccagttacctgcaaccccagatgaaatcgatcatgtcttt
gaagaggaacttctaacaaaagaatccaagaccaaagaagatgttaaagaaccagatgtg
tcagaagaattggatacaaaactccctcttgatggtggattagacaaaatggaagatatc
ccagaggaatgtgaaaatatttcctctttggtggcatttgaaaacctcaaggcaaatgtg
actgacataatgctaatcttgttagtggagaacataagtggcctgtctaatgatgacttt
caagtggaaataataagagattttgatgttgctgttgttacctttcaaaagcacatagat
actataagatttgttgatgattgtaccaagcaccattcaattaaacaacttcagctttct
ccaagacttctggaagtgacaaacacaatcagggttgaaaacctgccacctggtgctgat
gactacagtttaaaacttttctttgaaaatccctataatggagggggaagagttgccaat
gttgaatattttcctgaagagagttcagctctgattgaattttttgacagaaaagtgtta
gacaccatcatggccacaaaactcgacttcaataaaatgccactttctgtgttcccatac
tatgcctcattgggcacagccttgtatggaaaggagaagcctctgatcaagcttccagca
ccatttgaagagtcactagatcttcccttatggaagttcttacagaaaaagaatcacctc
attgaggagataaacgatgaaatgaggcgttgtcactgtgagctcacgtggtcccaactc
agtggtaaagttaccatcagaccagcagccaccttagtcaatgaaggaagaccgagaatc
aagacctggcaggcagatacttccacaacactctctagcatcaggtctaaatataaagtc
aacccaattaaagtggatccaacaatgtgggacaccataaaaaatgatgtgaaagatgac
aggattttgattgagtttgatacacttaaggagatggtaatcttagcagggaaatcagag
gatgtccaaagcattgaggtacaagtcagggagttaatagaaagcactactcaaaaaatt
aaaagggaagagcaaagtttgaaggaaaaaatgatcatttctccaggcaggtattttctt
ttgtgtcacagcagtctactggaccatttactcacggagtgcccagagatagagatttgt
tacgatagagtcactcaacacttgtgcttgaaaggacctagtgcagatgtgtataaagca
aagtgtgaaatccaggaaaaggtgtacaccatggctcagaaaaacattcaggtttctcct
gagatttttcagtttttgcaacaggtaaactggaaagaattctctaagtgtcttttcata
gcacagaagattcttgcactttatgagctagagggtacaactgttctcttaaccagctgt
tcttctgaagccctgttagaagcagaaaagcaaatgctcagtgccttaaattataagcgc
attgaagttgagaacaaagaagttcttcatggcaagaaatggaaagggctcactcacaat
ttgcttaagaaacaaaattcctccccaaacactgtaatcatcaatgagttaacttcagaa
accacagctgaagtcatcattacaggctgtgtaaaagaagtaaatgaaacctataaattg
ctttttaacttcgttgaacaaaacatgaaaatagagagactggttgaagtaaagccttcc
ttagttattgactatttaaagacagaaaagaagctattctggccaaagataaagaaggta
aatgtgcaggtaagtttcaatcctgagaacaaacaaaaaggcattttactaactggctca
aagaccgaagtactgaaggcagtggacattgtcaagcaagtctgggattcagtctgtgtt
aaaagtgtccatactgataagccaggagccaagcagttcttccaggataaagcacggttt
tatcaaagtgagatcaaacggttgtttggttgttacattgaactacaggagaatgaagta
atgaaggagggaggcagccccgctgggcagaagtgcttctctcggacagtcttggcccct
ggcgttgtgctgattgtgcagcagggtgacttggcacggcttcctgtcgatgtggtggtg
aatgcatctaatgaggaccttaagcattatggtggcctggccgctgcgctctcaaaagca
gctggccctgagctccaggccgactgtgaccagatagtgaagagagagggcagactccta
ccgggcaatgccaccatctccaaggcaggaaagctgccctaccaccacgtgatccatgca
gtggggccccgctggagcggatatgaggccccgaggtgtgtgtacctattaaggagagct
gtgcaactcagtctctgtctagccgaaaaatacaagtaccgatccatagccatcccagct
attagttctggagtctttggctttcccttaggccgatgcgtggagaccattgtttctgcc
atcaaggaaaacttccaattcaagaaggatggacactgcttgaaagaaatctaccttgtg
gatgtatctgagaagactgttgaggcctttgcagaagctgtgaaaactgtatttaaagcc
accctgccagatacagctgccccgccaggtttaccaccagcagcagcggggcctgggaaa
acatcatgggaaaaaggaagcctggtgtccccgggaggcctgcagatgctgttggtgaaa
gagggtgtgcagaatgctaagaccgatgttgttgtcaactccgttcccttggatctcgtg
cttagtagagggcctctttctaagtccctcttggaaaaagctggaccagagctccaggag
gaattggacacagttggacaaggggtggctgtcagcatgggcacagtgctcaaaaccagc
agctggaatctggactgtcgctatgtgcttcacgtggtagctccggagtggagaaatggt
agcacatcttcactcaagataatggaagacataatcagagaatgtatggagatcactgag
agcttgtccttaaaatcaattgcatttccagcaataggaacaggaaacttgggatttcct
aaaaacatattcgctgaattaatcatttcagaggtgttcaaatttagtagcaagaatcag
ctgaaaactttacaagaggttcactttctgctgcacccgagtgatcatgaaaatattcag
gcattttcagatgaatttgccagaagggctaatggaaatctcgtcagtgacaaaattccg
aaggctaaagatacacaaggtttttatgggactgtttctagccctgattcaggtgtgtat
gaaatgaagattggctccatcatcttccaggtggcttctggagatatcacgaaagaagag
gcagatgtgattgtaaattcaacatcaaactcattcaatctcaaagcaggggtctccaaa
gcaattttagaatgtgctggacaaaatgtagaaagggaatgttctcagcaagctcagcag
cgcaaaaatgattatataatcaccggaggtggatttttgaggtgcaagaatatcattcat
gtaattggtggaaatgatgtcaagagttcagtttcctctgttttgcaggagtgtgaaaaa
aaaaattactcatccatttgcctcccagccattgggacaggaaatgccaaacaacaccca
gataaggttgctgaagccataattgatgccattgaagactttgtccagaaaggatcagcc
cagtctgtgaaaaaagttaaagttgttatctttctgcctcaagtactggatgtgttttat
gccaacatgaagaaaagagaagggactcagctttcttcccaacagtctgtgatgtctaaa
cttgcatcatttttgggcttttcaaagcaatctccccaaaaaaagaatcatttggttttg
gaaaagaaaacagaatcagcaacttttcgggtgtgtggtgaaaatgtcacgtgtgtggaa
tatgctatctcctggctacaagacctgattgaaaaagaacagtgtccttacaccagtgaa
gatgagtgcatcaaagactttgatgaaaaggagtatcaggagttgaatgagctgcagaag
aagttaaatattaacatttccctggaccataagagacctttgattaaggttttgggaatt
agcagagatgtgatgcaggctagagatgaaattgaggcgatgatcaagagagttcgattg
gccaaagaacaggaatcccgggcagattgtatcagtgagtttatagaatggcagtataat
gacaataacacttctcattgttttaacaaaatgaccaatctgaaattagaggatgcaagg
agagaaaagaaaaaaacagttgatgtcaaaattaatcatcggcactacacagtgaacttg
aacacatacactgccacagacacaaagggccacagtttatctgttcagcgcctcacgaaa
tccaaagttgacatccctgcacactggagtgatatgaagcagcagaatttctgtgtggtg
gagctgctgcctagtgatcctgagtacaacacggtggcaagcaagtttaatcagacctgc
tcacacttcagaatagagaagattgagaggatccagaatccagatctctggaatagctac
caggcaaagaaaaaaactatggatgccaagaatggccagacaatgaatgagaagcaactc
ttccatgggacagatgccggctccgtgccacacgtcaatcgaaatggctttaaccgcagc
tatgccggaaagaatgctgtggcatatggaaagggaacctattttgctgtcaatgccaat
tattctgccaatgatacgtactccagaccagatgcaaatgggagaaagcatgtgtattat
gtgcgagtacttactggaatctatacacatggaaatcattcattaattgtgcctccttca
aagaaccctcaaaatcctactgacctgtatgacactgtcacagataatgtgcaccatcca
agtttatttgtggcattttatgactaccaagcatacccagagtaccttattacgtttaga
aaataa

DBGET integrated database retrieval system