KEGG   Homo sapiens (human): 5465Help
Entry
5465              CDS       T01001                                 

Gene name
PPARA, NR1C1, PPAR, PPARalpha, hPPAR
Definition
(RefSeq) peroxisome proliferator activated receptor alpha
  KO
K07294  peroxisome proliferator-activated receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04024  cAMP signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05160  Hepatitis C
Drug target
Aleglitazar: D08845
Bezafibrate: D01366
Choline fenofibrate: D08890
Ciprofibrate: D03521
Clofibrate (DG00358): D00279 D01208 D07724
Etofibrate: D07187
Fenofibrate: D00565
Gemfibrozil: D00334
Indeglitazar: D09350
Muraglitazar: D05091
Naveglitazar: D08949
Pemafibrate: D10711
Tesaglitazar: D01274
Theofibrate: D06102
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    5465 (PPARA)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    5465 (PPARA)
   04920 Adipocytokine signaling pathway
    5465 (PPARA)
   03320 PPAR signaling pathway
    5465 (PPARA)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5465 (PPARA)
   04931 Insulin resistance
    5465 (PPARA)
  Infectious diseases
   05160 Hepatitis C
    5465 (PPARA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5465 (PPARA)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   5465 (PPARA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 5465
NCBI-ProteinID: NP_001001928
OMIM: 170998
HGNC: 9232
Ensembl: ENSG00000186951
Vega: OTTHUMG00000150443
Pharos: Q07869(Tclin)
UniProt: Q07869 F1D8S4
Structure
PDB: 

Position
22q13.31
AA seq 468 aa AA seqDB search
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtggacacggaaagcccactctgccccctctccccactcgaggccggcgatctagag
agcccgttatctgaagagttcctgcaagaaatgggaaacatccaagagatttcgcaatcc
atcggcgaggatagttctggaagctttggctttacggaataccagtatttaggaagctgt
cctggctcagatggctcggtcatcacggacacgctttcaccagcttcgagcccctcctcg
gtgacttatcctgtggtccccggcagcgtggacgagtctcccagtggagcattgaacatc
gaatgtagaatctgcggggacaaggcctcaggctatcattacggagtccacgcgtgtgaa
ggctgcaagggcttctttcggcgaacgattcgactcaagctggtgtatgacaagtgcgac
cgcagctgcaagatccagaaaaagaacagaaacaaatgccagtattgtcgatttcacaag
tgcctttctgtcgggatgtcacacaacgcgattcgttttggacgaatgccaagatctgag
aaagcaaaactgaaagcagaaattcttacctgtgaacatgacatagaagattctgaaact
gcagatctcaaatctctggccaagagaatctacgaggcctacttgaagaacttcaacatg
aacaaggtcaaagcccgggtcatcctctcaggaaaggccagtaacaatccaccttttgtc
atacatgatatggagacactgtgtatggctgagaagacgctggtggccaagctggtggcc
aatggcatccagaacaaggaggcggaggtccgcatctttcactgctgccagtgcacgtca
gtggagaccgtcacggagctcacggaattcgccaaggccatcccaggcttcgcaaacttg
gacctgaacgatcaagtgacattgctaaaatacggagtttatgaggccatattcgccatg
ctgtcttctgtgatgaacaaagacgggatgctggtagcgtatggaaatgggtttataact
cgtgaattcctaaaaagcctaaggaaaccgttctgtgatatcatggaacccaagtttgat
tttgccatgaagttcaatgcactggaactggatgacagtgatatctccctttttgtggct
gctatcatttgctgtggagatcgtcctggccttctaaacgtaggacacattgaaaaaatg
caggagggtattgtacatgtgctcagactccacctgcagagcaaccacccggacgatatc
tttctcttcccaaaacttcttcaaaaaatggcagacctccggcagctggtgacggagcat
gcgcagctggtgcagatcatcaagaagacggagtcggatgctgcgctgcacccgctactg
caggagatctacagggacatgtactga

DBGET integrated database retrieval system