KEGG   Homo sapiens (human): 54664Help
Entry
54664             CDS       T01001                                 

Gene name
TMEM106B, HLD16
Definition
(RefSeq) transmembrane protein 106B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1356 Anti-TRAP LEA_2 DnaJ_CXXCXGXG
Motif
Other DBs
NCBI-GeneID: 54664
NCBI-ProteinID: NP_001127704
OMIM: 613413
HGNC: 22407
Ensembl: ENSG00000106460
Vega: OTTHUMG00000125537
Pharos: Q9NUM4(Tbio)
UniProt: Q9NUM4 A0A024R9Z1
Position
7p21.3
AA seq 274 aa AA seqDB search
MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEFTGRDSVT
CPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRS
IDVKYIGVKSAYVSYDVQKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKAR
LNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHS
EQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagtctctttctcatttgcctttgcattcaagcaaagaagatgcttatgatgga
gtcacatctgaaaacatgaggaatggactggttaatagtgaagtccataatgaagatgga
agaaatggagatgtctctcagtttccatatgtggaatttacaggaagagatagtgtcacc
tgccctacttgtcagggaacaggaagaattcctagggggcaagaaaaccaactggtggca
ttgattccatatagtgatcagagattaaggccaagaagaacaaagctgtatgtgatggct
tctgtgtttgtctgtctactcctttctggattggctgtgtttttccttttccctcgctct
atcgacgtgaaatacattggtgtaaaatcagcctatgtcagttatgatgttcagaagcgt
acaatttatttaaatatcacaaacacactaaatataacaaacaataactattactctgtc
gaagttgaaaacatcactgcccaagttcaattttcaaaaacagttattggaaaggcacgc
ttaaacaacataaccattattggtccacttgatatgaaacaaattgattacacagtacct
accgttatagcagaggaaatgagttatatgtatgatttctgtactctgatatccatcaaa
gtgcataacatagtactcatgatgcaagttactgtgacaacaacatactttggccactct
gaacagatatcccaggagaggtatcagtatgtcgactgtggaagaaacacaacttatcag
ttggggcagtctgaatatttaaatgtacttcagccacaacagtaa

DBGET integrated database retrieval system