KEGG   Homo sapiens (human): 5467Help
Entry
5467              CDS       T01001                                 

Gene name
PPARD, FAAR, NR1C2, NUC1, NUCI, NUCII, PPARB
Definition
(RefSeq) peroxisome proliferator activated receptor delta
  KO
K04504  peroxisome proliferator-activated receptor delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04310  Wnt signaling pathway
hsa05200  Pathways in cancer
hsa05221  Acute myeloid leukemia
Drug target
Indeglitazar: D09350
Sodelglitazar: D06647
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    5467 (PPARD)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    5467 (PPARD)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    5467 (PPARD)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    5467 (PPARD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5467 (PPARD)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    5467 (PPARD)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5467 (PPARD)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   5467 (PPARD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 5467
NCBI-ProteinID: NP_001165289
OMIM: 600409
HGNC: 9235
Ensembl: ENSG00000112033
Vega: OTTHUMG00000014567
Pharos: Q03181(Tchem)
UniProt: Q03181 A0A024RCW6
Structure
PDB: 

Position
6p21.31
AA seq 441 aa AA seqDB search
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccacaggaggaagcccctgaggtccgggaagaggaggagaaagaggaagtg
gcagaggcagaaggagccccagagctcaatgggggaccacagcatgcacttccttccagc
agctacacagacctctcccggagctcctcgccaccctcactgctggaccaactgcagatg
ggctgtgacggggcctcatgcggcagcctcaacatggagtgccgggtgtgcggggacaag
gcatcgggcttccactacggtgttcatgcatgtgaggggtgcaagggcttcttccgtcgt
acgatccgcatgaagctggagtacgagaagtgtgagcgcagctgcaagattcagaagaag
aaccgcaacaagtgccagtactgccgcttccagaagtgcctggcactgggcatgtcacac
aacgctatccgttttggtcggatgccggaggctgagaagaggaagctggtggcagggctg
actgcaaacgaggggagccagtacaacccacaggtggccgacctgaaggccttctccaag
cacatctacaatgcctacctgaaaaacttcaacatgaccaaaaagaaggcccgcagcatc
ctcaccggcaaagccagccacacggcgccctttgtgatccacgacatcgagacattgtgg
caggcagagaaggggctggtgtggaagcagttggtgaatggcctgcctccctacaaggag
atcagcgtgcacgtcttctaccgctgccagtgcaccacagtggagaccgtgcgggagctc
actgagttcgccaagagcatccccagcttcagcagcctcttcctcaacgaccaggttacc
cttctcaagtatggcgtgcacgaggccatcttcgccatgctggcctctatcgtcaacaag
gacgggctgctggtagccaacggcagtggctttgtcacccgtgagttcctgcgcagcctc
cgcaaacccttcagtgatatcattgagcctaagtttgaatttgctgtcaagttcaacgcc
ctggaacttgatgacagtgacctggccctattcattgcggccatcattctgtgtggagac
cggccaggcctcatgaacgttccacgggtggaggctatccaggacaccatcctgcgtgcc
ctcgaattccacctgcaggccaaccaccctgatgcccagtacctcttccccaagctgctg
cagaagatggctgacctgcggcaactggtcaccgagcacgcccagatgatgcagcggatc
aagaagaccgaaaccgagacctcgctgcaccctctgctccaggagatctacaaggacatg
tactaa

DBGET integrated database retrieval system