KEGG   Homo sapiens (human): 5467Help
Entry
5467              CDS       T01001                                 

Gene name
PPARD, FAAR, NR1C2, NUC1, NUCI, NUCII, PPARB
Definition
(RefSeq) peroxisome proliferator activated receptor delta
  KO
K04504  peroxisome proliferator-activated receptor delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04310  Wnt signaling pathway
hsa05200  Pathways in cancer
hsa05221  Acute myeloid leukemia
Drug target
Indeglitazar: D09350
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    5467 (PPARD)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    5467 (PPARD)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    5467 (PPARD)
   05221 Acute myeloid leukemia
    5467 (PPARD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5467 (PPARD)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    5467 (PPARD)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5467 (PPARD)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   5467 (PPARD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 5467
NCBI-ProteinID: NP_001165289
OMIM: 600409
HGNC: 9235
Ensembl: ENSG00000112033
Vega: OTTHUMG00000014567
Pharos: Q03181(Tchem)
UniProt: Q03181 A0A024RCW6
Structure
PDB: 

Position
6p21.31
AA seq 441 aa AA seqDB search
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccacaggaggaagcccctgaggtccgggaagaggaggagaaagaggaagtg
gcagaggcagaaggagccccagagctcaatgggggaccacagcatgcacttccttccagc
agctacacagacctctcccggagctcctcgccaccctcactgctggaccaactgcagatg
ggctgtgacggggcctcatgcggcagcctcaacatggagtgccgggtgtgcggggacaag
gcatcgggcttccactacggtgttcatgcatgtgaggggtgcaagggcttcttccgtcgt
acgatccgcatgaagctggagtacgagaagtgtgagcgcagctgcaagattcagaagaag
aaccgcaacaagtgccagtactgccgcttccagaagtgcctggcactgggcatgtcacac
aacgctatccgttttggtcggatgccggaggctgagaagaggaagctggtggcagggctg
actgcaaacgaggggagccagtacaacccacaggtggccgacctgaaggccttctccaag
cacatctacaatgcctacctgaaaaacttcaacatgaccaaaaagaaggcccgcagcatc
ctcaccggcaaagccagccacacggcgccctttgtgatccacgacatcgagacattgtgg
caggcagagaaggggctggtgtggaagcagttggtgaatggcctgcctccctacaaggag
atcagcgtgcacgtcttctaccgctgccagtgcaccacagtggagaccgtgcgggagctc
actgagttcgccaagagcatccccagcttcagcagcctcttcctcaacgaccaggttacc
cttctcaagtatggcgtgcacgaggccatcttcgccatgctggcctctatcgtcaacaag
gacgggctgctggtagccaacggcagtggctttgtcacccgtgagttcctgcgcagcctc
cgcaaacccttcagtgatatcattgagcctaagtttgaatttgctgtcaagttcaacgcc
ctggaacttgatgacagtgacctggccctattcattgcggccatcattctgtgtggagac
cggccaggcctcatgaacgttccacgggtggaggctatccaggacaccatcctgcgtgcc
ctcgaattccacctgcaggccaaccaccctgatgcccagtacctcttccccaagctgctg
cagaagatggctgacctgcggcaactggtcaccgagcacgcccagatgatgcagcggatc
aagaagaccgaaaccgagacctcgctgcaccctctgctccaggagatctacaaggacatg
tactaa

DBGET integrated database retrieval system