KEGG   Homo sapiens (human): 54675
Entry
54675             CDS       T01001                                 
Symbol
CRLS1, C20orf155, CLS, CLS1, GCD10, dJ967N21.6
Name
(RefSeq) cardiolipin synthase 1
  KO
K08744  cardiolipin synthase (CMP-forming) [EC:2.7.8.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    54675 (CRLS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.41  cardiolipin synthase (CMP-forming)
     54675 (CRLS1)
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-GeneID: 54675
NCBI-ProteinID: NP_061968
OMIM: 608188
HGNC: 16148
Ensembl: ENSG00000088766
Pharos: Q9UJA2(Tbio)
UniProt: Q9UJA2
Position
20:6005938..6040053
AA seq 301 aa
MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRL
PGIGQRNHCSGAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIPNMLSMTRIGL
APVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISIL
YVSLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTF
ISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFTTAASAYSYYHYGRKTVQVIK
D
NT seq 906 nt   +upstreamnt  +downstreamnt
atgctagccttgcgcgtggcgcgcggctcgtggggggccctgcgcggcgccgcttgggct
ccgggaacgcggccgagtaagcgacgcgcctgctgggccctgctgccgcccgtgccctgc
tgcttgggctgcctggccgaacgctggaggctgcgtccggccgctcttggcttgcggctg
cccgggatcggccagcggaaccactgttcgggcgcggggaaggcggctcccaggccagcg
gccggagcgggcgccgctgccgaagccccgggcggccagtggggcccggcgagcaccccc
agcctgtatgaaaacccatggacaatcccgaatatgttgtcaatgacgagaattggcttg
gccccagttctgggctatttgattattgaagaagattttaatattgcactaggagttttt
gctttagctggactaacagatttgttggatggatttattgctcgaaactgggccaatcaa
agatcagctttgggaagtgctcttgatccacttgctgataaaatacttatcagtatctta
tatgttagcttgacctatgcagatcttattccagttccacttacttacatgatcatttcg
agagatgtaatgttgattgctgctgttttttatgtcagataccgaactcttccaacacca
cgaacacttgccaagtatttcaatccttgctatgccactgctaggttaaaaccaacattc
atcagcaaggtgaatacagcagtccagttaatcttggtggcagcttctttggcagctcca
gttttcaactatgctgacagcatttatcttcagatactatggtgttttacagctttcacc
acagctgcatcagcttatagttactatcattatggccggaagactgttcaggtgataaaa
gactga

DBGET integrated database retrieval system