KEGG   Homo sapiens (human): 54676Help
Entry
54676             CDS       T01001                                 

Gene name
GTPBP2, JABELS
Definition
(RefSeq) GTP binding protein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D3
Motif
Other DBs
NCBI-GeneID: 54676
NCBI-ProteinID: NP_061969
OMIM: 607434
HGNC: 4670
Ensembl: ENSG00000172432
Vega: OTTHUMG00000014744
Pharos: Q9BX10(Tbio)
UniProt: Q9BX10 A0A024RD30
Position
6p21.1
AA seq 602 aa AA seqDB search
MDSRVSELFGGCCRPGGGPAVGGTLKARGAGSSSGCGGPKGKKKNGRNRGGKANNPPYLP
PEAEDGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEM
RASLKTLHRMAEKVGADITVLREREVDYDSDMPRKITEVLVRKVPDNQQFLDLRVAVLGN
VDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYS
DSRTAEEICESSSKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAGTTREH
LGLALALKVPFFIVVSKIDLCAKTTVERTVRQLERVLKQPGCHKVPMLVTSEDDAVTAAQ
QFAQSPNVTPIFTLSSVSGESLDLLKVFLNILPPLTNSKEQEELMQQLTEFQVDEIYTVP
EVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALG
DFDRALLRKGMVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVEK
IHAKDKLRTGEKAVVRFRFLKHPEYLKVGAKLLFREGVTKGIGHVTDVQAITAGEAQANM
GF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggactcgcgggtatcggagctgttcggcggctgctgccggcccggagggggcccggcc
gtgggcggaaccctcaaggctaggggggccggcagcagcagcggctgcggggggccaaag
ggaaagaagaagaacggaaggaacagagggggcaaagccaacaaccccccgtatttgccc
cccgaggctgaagatggaaacattgaatataaattgaagctggtgaatccatcccagtac
cgctttgagcacctggtgacacaaatgaagtggcggctccaggagggacgtggtgaggcc
gtctaccagattggggtagaggacaatgggctgctggtggggctggctgaggaggaaatg
cgagcttcgctcaagaccctgcaccggatggcagagaaggttggggcagacataaccgtt
cttcgagagcgagaagtggattatgatagcgacatgccccggaagatcaccgaggtgcta
gtacgaaaggtccctgacaaccaacagttcctagacctccgtgtggccgtcctggggaat
gtggactctgggaagtcaactctgcttggagtcctgacccagggagagctggacaatggg
cggggccgggctcggctcaaccttttccgccacctgcatgagattcagtctggccgaacc
tccagcatcagcttcgagatcctgggctttaacagcaagggagaggtggtgaattacagc
gactcacggacagcagaagagatctgtgagagcagctccaagatgatcaccttcatcgac
ctggcaggccaccataagtacctacacaccaccatctttggcctcacatcatactgcccc
gactgcgccctgctcctcgtcagtgccaacactgggattgctggcaccacaagggaacat
ctggggctggccctggccctgaaagtgcccttcttcatcgtggtcagcaagatcgaccta
tgtgccaagaccacagtggagaggacagtacgccagctggagcgggtcctcaagcagcct
ggctgccacaaggtccccatgctggtcacctctgaggatgatgccgtcactgctgcccag
cagtttgctcagtcacccaatgtcacccccatcttcacattgtccagtgtgtctggagag
agtctggacctcctcaaagtctttctgaatattctgccgccactcaccaacagcaaagag
caggaggaactcatgcagcagctgacggagttccaggtggatgaaatctacacagtacca
gaggtggggactgttgttggaggaacactttccagtgggatttgccgtgagggggaccag
ctggtggtgggccccacggatgatggctgcttcctggagctgagagtatgcagcatccag
cgcaaccgctctgcctgtcgtgtgctgcgagctggtcaggctgctacactggcgcttggg
gactttgaccgtgcactgcttcgcaagggcatggtgatggtgagcccggagatgaatcct
accatctgctcggtgtttgaggcagagatagtcttactgttccatgccaccaccttccga
cgaggattccaggtgacagtacacgtgggcaacgtacgtcagacggcagtggtggaaaag
atccatgccaaggacaaactgcggacaggcgagaaggcagtggtacgtttccgcttcctg
aaacacccagagtacctgaaggtgggcgccaaactgctgttccgggagggtgtcaccaag
ggcatcggccatgtcactgatgtacaagccattacagcaggagaagcccaggccaacatg
ggcttctga

DBGET integrated database retrieval system