KEGG   Homo sapiens (human): 5468
Entry
5468              CDS       T01001                                 
Symbol
PPARG, CIMT1, GLM1, NR1C3, PPARG1, PPARG2, PPARG5, PPARgamma
Name
(RefSeq) peroxisome proliferator activated receptor gamma
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04380  Osteoclast differentiation
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05016  Huntington disease
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05216  Thyroid cancer
hsa05417  Lipid and atherosclerosis
Network
nt06240  Transcription
nt06274  Thyroid cancer
  Element
N00126  PAX8-PPARG fusion to PPARG-mediated transcription
N00138  EWSR1-NR4A3
Disease
H00032  Thyroid cancer
H00409  Type 2 diabetes mellitus
H00420  Familial partial lipodystrophy
H02106  Genetic obesity
Drug target
Aleglitazar: D08845
Arhalofenate: D09579
Bocidelpar (DG03197): D12242 D12243
Ciglitazone: D03493
Darglitazone sodium: D03653
Edaglitazone sodium: D03941
Englitazone sodium: D03996
Farglitazar: D04132
Halofenate: D04411
Indeglitazar: D09350
Leriglitazone (DG03060): D11603 D11604
Lobeglitazone: D11923
Mifobate: D05030
Muraglitazar: D05091
Netoglitazone: D05150
Peliglitazar: D05397
Pioglitazone (DG00117): D00945<JP/US> D08378
Reglitazar: D01971
Rivoglitazone: D05739
Rosiglitazone (DG00116): D00596 D08491
Seladelpar (DG02957): D11256 D11257
Sodelglitazar: D06647
Tesaglitazar: D01274
Troglitazone: D00395
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    5468 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    5468 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5468 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    5468 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    5468 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5468 (PPARG)
   05202 Transcriptional misregulation in cancer
    5468 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    5468 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    5468 (PPARG)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    5468 (PPARG)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    5468 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5468 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    5468 (PPARG)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    5468 (PPARG)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   5468 (PPARG)
SSDB
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Other DBs
NCBI-GeneID: 5468
NCBI-ProteinID: NP_056953
OMIM: 601487
HGNC: 9236
Ensembl: ENSG00000132170
Pharos: P37231(Tclin)
UniProt: P37231
Structure
Position
3:12287368..12434344
AA seq 505 aa
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgggtgaaactctgggagattctcctattgacccagaaagcgattccttcactgataca
ctgtctgcaaacatatcacaagaaatgaccatggttgacacagagatgccattctggccc
accaactttgggatcagctccgtggatctctccgtaatggaagaccactcccactccttt
gatatcaagcccttcactactgttgacttctccagcatttctactccacattacgaagac
attccattcacaagaacagatccagtggttgcagattacaagtatgacctgaaacttcaa
gagtaccaaagtgcaatcaaagtggagcctgcatctccaccttattattctgagaagact
cagctctacaataagcctcatgaagagccttccaactccctcatggcaattgaatgtcgt
gtctgtggagataaagcttctggatttcactatggagttcatgcttgtgaaggatgcaag
ggtttcttccggagaacaatcagattgaagcttatctatgacagatgtgatcttaactgt
cggatccacaaaaaaagtagaaataaatgtcagtactgtcggtttcagaaatgccttgca
gtggggatgtctcataatgccatcaggtttgggcggatgccacaggccgagaaggagaag
ctgttggcggagatctccagtgatatcgaccagctgaatccagagtccgctgacctccgg
gccctggcaaaacatttgtatgactcatacataaagtccttcccgctgaccaaagcaaag
gcgagggcgatcttgacaggaaagacaacagacaaatcaccattcgttatctatgacatg
aattccttaatgatgggagaagataaaatcaagttcaaacacatcacccccctgcaggag
cagagcaaagaggtggccatccgcatctttcagggctgccagtttcgctccgtggaggct
gtgcaggagatcacagagtatgccaaaagcattcctggttttgtaaatcttgacttgaac
gaccaagtaactctcctcaaatatggagtccacgagatcatttacacaatgctggcctcc
ttgatgaataaagatggggttctcatatccgagggccaaggcttcatgacaagggagttt
ctaaagagcctgcgaaagccttttggtgactttatggagcccaagtttgagtttgctgtg
aagttcaatgcactggaattagatgacagcgacttggcaatatttattgctgtcattatt
ctcagtggagaccgcccaggtttgctgaatgtgaagcccattgaagacattcaagacaac
ctgctacaagccctggagctccagctgaagctgaaccaccctgagtcctcacagctgttt
gccaagctgctccagaaaatgacagacctcagacagattgtcacggaacacgtgcagcta
ctgcaggtgatcaagaagacggagacagacatgagtcttcacccgctcctgcaggagatc
tacaaggacttgtactag

DBGET integrated database retrieval system