KEGG   Homo sapiens (human): 54707
Entry
54707             CDS       T01001                                 

Gene name
GPN2, ATPBD1B
Definition
(RefSeq) GPN-loop GTPase 2
  KO
K24104  GPN-loop GTPase
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    54707 (GPN2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     54707 (GPN2)
SSDB
Motif
Pfam: ATP_bind_1 MeaB CbiA AAA_31 AAA_30 AAA_22 CLP1_P AAA_16 AAA_24 AAA_17 AAA_18 AAA_33 SRP54 AAA_5
Other DBs
NCBI-GeneID: 54707
NCBI-ProteinID: NP_060536
HGNC: 25513
Ensembl: ENSG00000142751
Vega: OTTHUMG00000004227
Pharos: Q9H9Y4(Tdark)
UniProt: Q9H9Y4
Position
1p36.11
AA seq 310 aa
MAGAAPTTAFGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDV
GELVGLGDVMDALRLGPNGGLLYCMEYLEANLDWLRAKLDPLRGHYFLFDCPGQVELCTH
HGALRSIFSQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHINLLSKM
DLIEHYGKLAFNLDYYTEVLDLSYLLDHLASDPFFRHYRQLNEKLVQLIEDYSLVSFIPL
NIQDKESIQRVLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSN
QSVEQEAMQL
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcaggggccgctccgaccacggccttcgggcaggcggtgatcggcccgccgggctca
gggaagaccacgtactgcctgggcatgagtgagttcctgcgcgcgctgggccggcgcgtg
gcggtggtgaacctggacccggccaacgaggggctgccgtacgagtgtgccgtggacgtg
ggcgagctggtggggctgggcgacgtgatggacgcgctgcgcctggggcccaacggcggc
ctgctctactgcatggagtacctggaagccaacctggactggctgcgtgccaagctcgac
cccctccgcggccactacttcctcttcgactgcccaggccaggtggagctctgcacgcat
cacggcgccttgcgcagcatcttctcccaaatggcgcagtgggacctcaggctgactgcc
gtccacctcgtggattctcactactgcacagaccctgccaagttcatttcagtactgtgt
acctccctggccaccatgctgcacgtggaactgccccacatcaacctcctttccaagatg
gacctcattgagcattatgggaagctggccttcaacctggactactacacagaggttctg
gacctctcctacctgcttgaccacctggcttctgaccctttcttccgccactaccgccag
ctcaatgagaagctagtgcagctcatcgaagactatagccttgtctcctttatccctctc
aacatccaggacaaggagagcatccagcgagtcctgcaggctgtggataaagccaatgga
tactgtttcagagcccaagagcagcgaagcttggaagccatgatgtctgccgcaatggga
gccgacttccatttctcttccacactgggcatccaggagaagtacctggcaccctcgaac
cagtcagtggagcaggaagccatgcagctgtag

DBGET integrated database retrieval system