KEGG   Homo sapiens (human): 54716
Entry
54716             CDS       T01001                                 

Gene name
SLC6A20, IMINO, SIT1, XT3, Xtrp3
Definition
(RefSeq) solute carrier family 6 member 20
  KO
K05048  solute carrier family 6 (neurotransmitter transporter, amino acid/orphan) member 15/16/17/18/20
Organism
hsa  Homo sapiens (human)
Disease
H00905  Iminoglycinuria
H01304  Hyperglycinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    54716 (SLC6A20)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   54716 (SLC6A20)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 54716
NCBI-ProteinID: NP_064593
OMIM: 605616
HGNC: 30927
Ensembl: ENSG00000163817
Vega: OTTHUMG00000133446
Pharos: Q9NP91(Tbio)
UniProt: Q9NP91
Position
3p21.31
AA seq 592 aa
MEKARPLWANSLQFVFACISYAVGLGNVWRFPYLCQMYGGGSFLVPYIIMLIVEGMPLLY
LELAVGQRMRQGSIGAWRTISPYLSGVGVASVVVSFFLSMYYNVINAWAFWYLFHSFQDP
LPWSVCPLNGNHTGYDEECEKASSTQYFWYRKTLNISPSLQENGGVQWEPALCLLLAWLV
VYLCILRGTESTGKVVYFTASLPYCVLIIYLIRGLTLHGATNGLMYMFTPKIEQLANPKA
WINAATQIFFSLGLGFGSLIAFASYNEPSNNCQKHAIIVSLINSFTSIFASIVTFSIYGF
KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSL
ESELDTAVQGTGLAFIVYTEAIKNMEVSQLWSVLYFFMLLMLGIGSMLGNTAAILTPLTD
SKIISSHLPKEAISGLVCLVNCAIGMVFTMEAGNYWFDIFNDYAATLSLLLIVLVETIAV
CYVYGLRRFESDLKAMTGRAVSWYWKVMWAGVSPLLIVSLFVFYLSDYILTGTLKYQAWD
ASQGQLVTKDYPAYALAVIGLLVASSTMCIPLAALGTFVQRRLKRGDADPVA
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggagaaagcgcggccgctgtgggccaactcgctacagttcgtgttcgcctgcatctcg
tacgccgtgggcctgggcaacgtgtggcgattcccgtacctgtgccagatgtacggcgga
ggtagtttcctggtcccctacatcatcatgcttatcgtggagggaatgccgctcttgtac
ctggaactggctgtggggcagcgcatgcggcagggcagcatcggcgcctggaggaccatc
agcccgtacctcagtggtgtcggggtcgccagcgtggtggtctctttcttcctctccatg
tactacaacgtcatcaacgcctgggccttctggtacctcttccactccttccaggatccc
ctgccgtggtctgtctgcccactgaatggtaaccacacgggctacgatgaggagtgtgag
aaggcgtcctccacacagtacttctggtacaggaaaaccctcaatatctcgccgtccctc
caggagaacgggggtgtgcagtgggagccggcgctgtgcctcctcctggcctggctggtg
gtgtacctgtgcatcctgcgtggcaccgagtccactggcaaggtggtgtatttcacggcg
tcactgccctattgcgtgctcatcatctacctcatcaggggcctcacgctccacggagcc
accaatggcctcatgtacatgttcactcccaagatagagcagctggccaaccccaaggcc
tggatcaatgcagccacccagatcttcttctcacttggcctgggcttcggcagcctgatc
gccttcgccagctacaatgagccatccaacaactgccagaagcacgccatcatcgtgtcc
ctcatcaacagcttcacctccatatttgccagcattgtcaccttctccatctatggcttc
aaggccaccttcaattatgaaaactgcttgaagaaggtgagtctgctgctgaccaacact
tttgaccttgaagatggctttttgacagccagcaacctggagcaggtgaagggctacctc
gcatctgcctacccaagcaaatacagcgagatgttcccgcaaatcaaaaactgcagcttg
gaatcggagctagacacggccgtccagggcactggcctggcattcatcgtctacacagag
gccattaaaaacatggaggtgtcccagctgtggtcggtgctctacttcttcatgctgctg
atgctgggcattgggagcatgctggggaacacagcggccatcctcacccctctgacagac
agcaagatcatctccagccacctgcccaaggaggccatctcaggtctggtgtgccttgtc
aactgtgccattggcatggtgttcacgatggaggctgggaactactggtttgacatattc
aacgactacgcggccacactgtccctgctgctcatcgtgctggtggagacgattgccgtg
tgctacgtgtacgggctgaggagatttgaaagtgaccttaaggccatgaccggccgagct
gtgagctggtactggaaggtgatgtgggctggcgtaagcccactgctgattgtcagcctc
tttgtcttctacctgagcgactacatcctcacggggaccctgaagtatcaagcctgggac
gcctcccagggccagctcgtgaccaaagattacccggcctatgcactggctgtcatcggg
ctgcttgtggcctcctccaccatgtgcatccccctggcggccctggggacttttgttcag
cgtcgcctcaagaggggagacgcagaccccgtggcctga

DBGET integrated database retrieval system